KEGG   Treponema azotonutricium: TREAZ_0512Help
Entry
TREAZ_0512        CDS       T01506                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
taz  Treponema azotonutricium
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:taz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TREAZ_0512 (folK)
Enzymes [BR:taz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     TREAZ_0512 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1970986..1971477
Genome map
AA seq 163 aa AA seqDB search
MPLVVLGLGSNQGDSLRILEKAVEVLGIILGSLRQASIYETVPLHVTDQPKFFNTAVAGE
YSKEPWALLSEIHKVEASFGRDRSKERRWGERTLDIDILLFGDQIIANHPLLEVPHPRLK
ERRFALEPLLELCPDAIDPASGIQYSGICRALPEQGIRRISGV
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgccgctggtagttttggggcttggttcaaatcagggggactctctccgaattttggaa
aaagccgtggaggttctgggaatcatcctgggatctctgcggcaagcttcaatttacgag
accgtccccctccatgtaacagatcagcccaagttcttcaacactgcggtggccggagaa
tacagcaaggagccatgggcccttctttcagagattcacaaagttgaagcctctttcggc
agggatcgttccaaagaacgccgctggggtgaacgcaccctggacatcgacatactcctc
tttggcgatcagatcatagccaatcaccccctgctggaagtccctcatccccgtttaaag
gaacgccgtttcgcccttgaacctctccttgaactctgccctgatgccatcgacccggca
agcggcatacagtattcaggaatatgcagagccctgcctgagcagggtatacggcggatt
tccggagtctag

DBGET integrated database retrieval system