KEGG   Treponema azotonutricium: TREAZ_0745Help
Entry
TREAZ_0745        CDS       T01506                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
taz  Treponema azotonutricium
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:taz00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:taz00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:taz00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1738421..1739755
Genome map
AA seq 444 aa AA seqDB search
MAKFAFIGAGSFGFTRGLVKDILSFDAFKDATIALMDINDERLAYITRAVEKIIKAGNYA
AKVVSTKSRAEALAGADGVLCTILNGDVDVWRYDIEIPKEFGVDINVGDTRGPSGIFRAL
RTIPVMLDICKDIEKYCPNATFLNYTNPMAMLCRAMQSKFPKLRISGLCHSVQGTAEMLA
KWIGADPGDISFTCAGINHQAFYLDYRWKGVDAYPRIREALKDPKVYNEEIVRNEMYLLL
DYYPTESSGHNSEYNAWFRKRPDLIEKFCIPGTGWNPGAYAYILKEYENRKGTWKKDWDE
WLANPEVDLKRGHEYAAYIFNAVFGDKTLFKFNGNVLNKGFIDNLPQDACVEVPVLASPH
GLEAIKVGKLPNQLAALVHTSAICEELAVDGSLTGDPRKVYQAIAFDPLTSAVLGIHEIK
DMTEKMLLRNKDYLPQFSTYTVGK
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggctaaattcgcatttatcggcgccgggagcttcggcttcaccagggggttggttaag
gatatcctttctttcgacgccttcaaggatgccactatcgcactcatggacatcaatgac
gagaggctggcgtacatcaccagggcagtggaaaagatcataaaggccgggaactatgcg
gccaaggtcgtctccaccaagagcagggcggaggccctcgcaggggccgacggcgtgctt
tgcaccatacttaacggcgacgtggacgtgtggcgctatgacattgaaatccccaaggaa
ttcggggtggacatcaacgtgggcgacacccgggggccttcgggcatattcagggccctc
cgcaccatcccggtgatgctggatatttgcaaggacattgaaaagtactgccccaacgca
accttcctcaactacaccaaccccatggccatgctttgccgtgccatgcaaagcaaattc
cccaaattgaggatttcgggcctctgccacagcgtgcaggggactgcggaaatgcttgcc
aagtggataggcgccgaccctggcgacatcagctttacctgcgccggcatcaaccaccag
gctttttacctggattatcgctggaagggcgtcgacgcctaccccaggatcagggaagcc
ctgaaagacccgaaagtctacaatgaggaaatcgtgcggaacgagatgtacctgctcctg
gattactatcctaccgaatcttcggggcacaactcggaatacaacgcatggttccgcaag
cggcccgacctgattgagaaattctgcatcccgggcacagggtggaaccccggcgcctat
gcctatatcctcaaggaatacgagaaccgcaagggcacctggaagaaggattgggacgaa
tggcttgcgaaccccgaggtggatctgaagcggggccatgaatacgcggcctatatattc
aatgccgttttcggggacaagacccttttcaaattcaacgggaatgtgctgaacaagggt
tttatcgacaacctcccccaggatgcctgcgtggaagtgccggtgctggcttccccccac
gggcttgaggccatcaaggtggggaagctccccaaccagctcgcggccctggtgcatacc
tcggcaatctgcgaggagcttgcagtggacggctccctcacaggggatccccgcaaggtg
taccaggccattgcattcgatcccctgacttcggcagtcctgggcatacatgaaatcaag
gatatgaccgaaaagatgctcctccggaacaaggattaccttccccaattttcaacttat
acggttggcaaataa

DBGET integrated database retrieval system