KEGG   Treponema azotonutricium: TREAZ_0884Help
Entry
TREAZ_0884        CDS       T01506                                 

Definition
(GenBank) pyrazinamidase/nicotinamidase (PZAase)(Nicotine deamidase) (NAMase)
  KO
K08281  nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
taz  Treponema azotonutricium
Pathway
taz00760  Nicotinate and nicotinamide metabolism
taz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:taz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    TREAZ_0884
Enzymes [BR:taz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     TREAZ_0884
    3.5.1.-  
     TREAZ_0884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase
Motif
Other DBs
NCBI-ProteinID: AEF82157
UniProt: F5Y8Z9
Position
complement(1577382..1578029)
Genome map
AA seq 215 aa AA seqDB search
MNIDFSASVLIEIDVQNDFCPGGALAVAQGNEVVKPLNNLAGLFASHSGHVVATQDWHPE
NHVSFAASHTGKKPGDSIDLPETKGQLLWPAHCVQGSAGACFHKELDLSPVSLILRKGFR
ESLDSYSAFFENDQETSTGLEGFLKNLGIKTVVIGGLATDYCVLYSALDAARLNFHTIVL
RDAVRGVGYPEGSIEGAFKSLEAADVLIFDSKEIL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgatttttcagcttcggttctcatcgaaattgatgtgcagaacgacttctgc
cccggcggagctttggcagtggcccagggcaatgaagtggtaaagccccttaacaatctg
gccggattgttcgcctctcatagcgggcatgtcgtcgctacccaggactggcaccctgaa
aaccatgtatcatttgcggcttcccatacgggaaaaaagcccggcgatagcattgacctc
cctgaaactaaagggcagttgctttggccggcacattgcgtgcagggcagcgcaggcgca
tgcttccataaagaattggatttatcgcctgtcagcctcatactgcgcaagggttttagg
gaaagcctcgattcctattcggcattttttgaaaatgaccaagaaacttccacaggcctt
gaagggttcctgaaaaacctgggcataaaaactgtagtcataggcgggcttgcgaccgac
tattgcgtgctttacagcgctttggatgcagccaggctgaactttcatactatcgtttta
agggatgcggtcaggggggttggatatcccgaaggttccatagaaggggctttcaaatcc
cttgaagccgcggacgtcctcatctttgattcaaaagaaatactatga

DBGET integrated database retrieval system