KEGG   Treponema azotonutricium: TREAZ_1018Help
Entry
TREAZ_1018        CDS       T01506                                 

Definition
(GenBank) ROK domain protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
taz  Treponema azotonutricium
Pathway
taz00010  Glycolysis / Gluconeogenesis
taz00052  Galactose metabolism
taz00500  Starch and sucrose metabolism
taz00520  Amino sugar and nucleotide sugar metabolism
taz00521  Streptomycin biosynthesis
taz00524  Neomycin, kanamycin and gentamicin biosynthesis
taz01100  Metabolic pathways
taz01110  Biosynthesis of secondary metabolites
taz01120  Microbial metabolism in diverse environments
taz01130  Biosynthesis of antibiotics
taz01200  Carbon metabolism
Module
taz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:taz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TREAZ_1018
   00052 Galactose metabolism
    TREAZ_1018
   00500 Starch and sucrose metabolism
    TREAZ_1018
   00520 Amino sugar and nucleotide sugar metabolism
    TREAZ_1018
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TREAZ_1018
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    TREAZ_1018
Enzymes [BR:taz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     TREAZ_1018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase
Motif
Other DBs
NCBI-ProteinID: AEF82672
UniProt: F5Y864
Position
complement(1442540..1443436)
Genome map
AA seq 298 aa AA seqDB search
MGGSKFLVGLVDSSGEILCSKKHHWSELSPRGVVADVKTAAHALLEANPNLKPQVMGATI
PGLADPEKGIWVESSFSGIRDLPFASIMEKEFGLPVKLDNDVRACALAEYRLGCCKGIDH
FVWITVSNGIGGCVFAGGKPYRGGSGNAGEIGHIIVEEGPGARLCKAGHQGCAEVHASGQ
GLAKNYISLGGRAQPGKQPPDAKAIDALARAGDQTAIDAYKLEGLYLGRAIGAAVNLLSP
DKVVIGGGVSLGFDLFWPSLEETLKTHVYQNANPRLSVEPSLLGYNAALLGAAVLSFS
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgggaggctcgaagttccttgtagggctggtcgattcctcgggggagattctctgttca
aaaaagcaccactggtccgaactaagcccccggggagtggttgccgatgtaaagaccgca
gcccacgccttgctggaagccaaccccaatttgaaaccccaagtgatgggggccaccata
ccaggccttgcggacccggaaaaaggcatttgggtggagtcgagtttttcgggcatacgg
gatctgccctttgcctcaatcatggaaaaagaattcggcctccccgtaaaacttgataac
gatgtgcgggcctgcgccctggccgaataccggctcggctgctgcaaggggatagatcac
tttgtctggatcaccgtgtccaatggcattggaggctgcgtctttgccggcgggaagccc
taccgggggggctcggggaatgccggggagataggccatatcattgttgaagaaggcccc
ggcgcccggttatgcaaggcaggccatcagggctgcgccgaggtgcacgcgtcaggccag
gggctggcaaaaaactacatctccctggggggaagggcccagccagggaagcaacctccc
gatgccaaagccatcgatgccctggcccgcgccggagaccagacagccatagacgcctac
aaactggagggcctttacctgggccgtgcaatcggggcagcagtcaatctcttaagcccc
gacaaggttgtaatcggcggcggtgtctccctgggcttcgacctcttttggccatccctg
gaagaaacccttaaaacccatgtctaccaaaacgccaacccccgcctcagcgtggagcca
agcctcctgggttacaacgcagccctcctgggagccgcggttttgagcttctcgtga

DBGET integrated database retrieval system