KEGG   Treponema azotonutricium: TREAZ_1141Help
Entry
TREAZ_1141        CDS       T01506                                 

Definition
esterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
taz  Treponema azotonutricium
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:taz00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    TREAZ_1141
Enzymes [BR:taz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     TREAZ_1141
   3.1.2  Thioester hydrolases
    3.1.2.-  
     TREAZ_1141
Lipid biosynthesis proteins [BR:taz01004]
 Fatty acid synthase
  Component type
   TREAZ_1141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1301552..1302292
Genome map
AA seq 246 aa AA seqDB search
MNKYFCIKLSIFITIFVLLAACCSMAKNVGYKYIPIPENSQKKVLTRPIVCLGDSLTEGY
VSSMVGIVDREHSYPAFLQEKVNVQVVNSGISGNTTKETLDRIEKDVLAYNPDMVIVFLG
TNDFFLRDLPLEETQENLQKILDKINDGDRLIFLVKFYSNQILERFMSWKEWSVRRWQST
INKYDSMFEELAHKNNAVLISGVWEGIDIEADMPDSVHPDTHGYWLIEENIFLAVKSYIS
EENLIE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
gtgaataaatatttttgcataaaactgtcaatttttataacaatctttgtactattggcc
gcatgttgcagcatggcgaaaaatgttggctataagtatatccccatcccggaaaattca
caaaaaaaggtccttacgaggcctattgtttgtcttggagacagtcttacggaaggatat
gtctcttcaatggttggtattgtggatcgggaacattcatatccggcatttttacaggaa
aaggtcaatgttcaggttgttaattccgggataagcggcaatacaaccaaggaaacgttg
gataggattgaaaaagatgttcttgcgtacaaccccgatatggttattgtgtttcttgga
acaaacgacttttttttaagggatcttcctttggaagaaactcaggaaaacttacagaag
atcctggataaaatcaatgacggcgacaggctgatattccttgtaaaattttattcaaac
caaatactggaaaggtttatgagctggaaggaatggtctgtaaggaggtggcaaagcaca
attaataaatatgatagtatgtttgaagaattggcgcataaaaataacgcagtattgatt
agcggagtctgggagggaattgatattgaggcggatatgcccgattcggttcatccagat
acgcatggttattggcttattgaagaaaatatctttttagctgtaaaatcatacatctct
gaagaaaatctgatagaatag

DBGET integrated database retrieval system