KEGG   Treponema azotonutricium: TREAZ_1141Help
Entry
TREAZ_1141        CDS       T01506                                 

Definition
esterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
taz  Treponema azotonutricium
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:taz01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1301552..1302292
Genome map
AA seq 246 aa AA seqDB search
MNKYFCIKLSIFITIFVLLAACCSMAKNVGYKYIPIPENSQKKVLTRPIVCLGDSLTEGY
VSSMVGIVDREHSYPAFLQEKVNVQVVNSGISGNTTKETLDRIEKDVLAYNPDMVIVFLG
TNDFFLRDLPLEETQENLQKILDKINDGDRLIFLVKFYSNQILERFMSWKEWSVRRWQST
INKYDSMFEELAHKNNAVLISGVWEGIDIEADMPDSVHPDTHGYWLIEENIFLAVKSYIS
EENLIE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
gtgaataaatatttttgcataaaactgtcaatttttataacaatctttgtactattggcc
gcatgttgcagcatggcgaaaaatgttggctataagtatatccccatcccggaaaattca
caaaaaaaggtccttacgaggcctattgtttgtcttggagacagtcttacggaaggatat
gtctcttcaatggttggtattgtggatcgggaacattcatatccggcatttttacaggaa
aaggtcaatgttcaggttgttaattccgggataagcggcaatacaaccaaggaaacgttg
gataggattgaaaaagatgttcttgcgtacaaccccgatatggttattgtgtttcttgga
acaaacgacttttttttaagggatcttcctttggaagaaactcaggaaaacttacagaag
atcctggataaaatcaatgacggcgacaggctgatattccttgtaaaattttattcaaac
caaatactggaaaggtttatgagctggaaggaatggtctgtaaggaggtggcaaagcaca
attaataaatatgatagtatgtttgaagaattggcgcataaaaataacgcagtattgatt
agcggagtctgggagggaattgatattgaggcggatatgcccgattcggttcatccagat
acgcatggttattggcttattgaagaaaatatctttttagctgtaaaatcatacatctct
gaagaaaatctgatagaatag

DBGET integrated database retrieval system