KEGG   Treponema azotonutricium: TREAZ_1582Help
Entry
TREAZ_1582        CDS       T01506                                 

Definition
PfkB protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
taz  Treponema azotonutricium
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:taz00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TREAZ_1582
Enzymes [BR:taz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     TREAZ_1582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(790175..791074)
Genome map
AA seq 299 aa AA seqDB search
MKILVYGAINIDLIFSVDHIAMPGETVSAGDFKRGPGGKGSNQAAALAKAGVPVYLAGKI
GHDGEFLLELLRSYKVDTSLVTIYEGATGNALIQVDKNGQNAIVPYAGGNGAITVEEVNK
VLGNFGKDDIVILQNEIVHAAEIIAEAKKRGLKVCFNPSPYDEKISSVPLDLVDTFFVNE
LEGAALAAEGGTGGADKNAPFPVILEKLVTKFPHAEIILTAGKEGAFYGFKNERAKGDIV
DIPVVDTTGAGDTFSGYFIAARARGIDVNEALRLACKASSIAVSRPGAMEAVPFASEVF
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatacttgtatacggggccatcaatatcgatcttattttttctgtggatcatatt
gccatgcccggcgagacggtgagcgcaggcgattttaaacgcggacccgggggcaaggga
tcaaaccaggcggcggcactggcaaaggcaggggtgccggtatacctggccgggaaaatt
ggccatgatggcgagttccttttggaactgctgcgcagttataaagttgatacgagcctt
gtcaccatttatgagggggctacaggcaacgcgctcattcaggttgataaaaacggacag
aacgccatagtcccttatgcggggggcaatggtgcaattactgtggaagaagtcaataaa
gtgctcggcaactttggcaaggacgatatcgtcattttgcaaaatgaaattgtacatgca
gcggaaatcatcgccgaggccaagaagcggggcctcaaggtttgctttaacccttcaccg
tacgatgaaaaaatttcttccgtgcccctggatctcgtggacaccttcttcgtaaatgaa
ctcgagggcgcagctctcgctgccgagggcggaaccggcggtgccgacaagaatgcgcct
ttcccggttatcctcgaaaaactggtaacgaaatttccacatgcggagatcatcctcact
gcgggaaaagaaggagccttctacggattcaaaaacgaaagagccaagggcgatatagtg
gatattccggtagtggacaccaccggcgcaggagatacgttttcaggttattttatcgcg
gccagggcaagaggcatcgatgtcaacgaagctctgcgcctcgcgtgcaaggcttcgtcc
attgcggtatccaggcccggggccatggaagcagttccttttgcaagcgaagtcttttaa

DBGET integrated database retrieval system