KEGG   Treponema azotonutricium: TREAZ_1681Help
Entry
TREAZ_1681        CDS       T01506                                 

Definition
(GenBank) peroxiredoxin Hyr1
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
taz  Treponema azotonutricium
Pathway
taz00480  Glutathione metabolism
taz00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:taz00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    TREAZ_1681
  Metabolism of other amino acids
   00480 Glutathione metabolism
    TREAZ_1681
Enzymes [BR:taz01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     TREAZ_1681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AEF80663
UniProt: F5YCS0
Position
complement(698574..699104)
Genome map
AA seq 176 aa AA seqDB search
MNLYDFTVADREGKPISLADYKGKVLLIVNTATKCGLTPQYEGLQKLYETHHAKGFEILD
FPCNQFGGQAPGSAEEIAEFCTINFHTTFPQFAKIDVNGDKAAPLFVYLKNQAEETEDEG
AAALKERLKGFSSFTGAKDIKWNFSKFLVNRDGKVEAWFFPTYNPEKLSSVIERLL
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatatgattttacggtagcagaccgcgaaggaaaaccgatttctcttgccgac
tataagggaaaagtgcttttgattgtgaataccgccaccaaatgcggactgacgccgcaa
tatgagggtttgcaaaaactatacgaaacccatcacgccaaaggttttgaaatcttggat
tttccctgcaatcaatttggcggacaggctccgggcagcgcagaggaaattgcagaattt
tgtacaataaattttcacactactttcccgcagtttgccaagattgatgtaaatggtgac
aaagccgcgcctctttttgtgtatctcaaaaatcaggctgaagaaaccgaagatgaaggg
gcagcggctctcaaagaacggctcaaaggattttcttctttcaccggagcaaaggacatt
aaatggaatttttccaaatttcttgtcaaccgggacggcaaagtggaagcatggtttttt
ccgacatataaccccgaaaaattgtcgtctgtaattgaacgattactctaa

DBGET integrated database retrieval system