KEGG   Treponema azotonutricium: TREAZ_1794Help
Entry
TREAZ_1794        CDS       T01506                                 

Gene name
recR
Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
taz  Treponema azotonutricium
Pathway
taz03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:taz00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TREAZ_1794 (recR)
DNA repair and recombination proteins [BR:taz03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     TREAZ_1794 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      TREAZ_1794 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_5 Nop10p IMS_HHH Med16
Motif
Other DBs
NCBI-ProteinID: AEF83296
UniProt: F5YC10
Position
complement(572898..573506)
Genome map
AA seq 202 aa AA seqDB search
MTPGNALDRLTALLSRLPGIGKKTAGRLAYHILDTDPAYAHSLASELDNLHDAIKRCSRC
GAYTESDPCPICSDPSRDRALLCVVERAQDLRVIEESREYRGLFHVLGGLIAPLEGVGPG
DLSIGKLASRIQEEGTRELILALNPTIEGDTTALYLQQFLKEKLKGSPLEITRLASGLPV
GGDLEYADRLTLSRSFRGRIKL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgacaccggggaatgccctcgacaggctcactgccctcctttcaaggctcccgggaatc
gggaaaaaaaccgcgggccgtcttgcctatcatatacttgatactgatcccgcatacgcc
cattccctagcctccgaacttgacaaccttcacgatgccataaaacgctgttcacgctgc
ggggcttacaccgaaagcgacccctgccctatatgctccgacccaagccgtgaccgcgcg
cttttatgcgtggtagagcgggcccaggatctgcgggtcatcgaagaatcccgcgaatac
cgtggcctcttccatgtgctcggcggcctcattgcccccctcgaaggcgttggccccggg
gatctttccatcgggaaactcgcaagccgcattcaggaagagggaacccgggaacttatc
cttgcccttaaccccacgattgagggggacaccacagccctctacctgcagcaattttta
aaagaaaaactgaaaggctcccccctcgaaatcacccgcctggcttcgggccttcctgta
gggggcgaccttgaatatgcagacaggctcaccctgtcccgtagtttcagaggcaggatt
aagctataa

DBGET integrated database retrieval system