KEGG   Treponema azotonutricium: TREAZ_1811Help
Entry
TREAZ_1811        CDS       T01506                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
taz  Treponema azotonutricium
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:taz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TREAZ_1811 (malQ)
Enzymes [BR:taz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     TREAZ_1811 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
554033..555505
Genome map
AA seq 490 aa AA seqDB search
MERAAGILLAVSSLPSPYGIGSFGTAGREWCDFLAKAGQKYWQILPLGPTGWGNSPYQSF
SAFAVSSYYIDLDTLASEGLLKKGEAEKIVWGSRPGSVNYGALYHRREKILRLAFEKFRL
VKAFKDFREKNAFWLEDYSLFMALKKANQGKAWLDWEEGLRFRKKDALAKAREDYIEEID
YHVFVQYQAFRQWSALKHYANSRGISIIGDMPIYVSMDSSDTWANSDLFQLDKDLRPIRV
SGCPPDPFAADGQLWGNPLYRWDYIRKTNFAWWILRLRESLSLYDVVRIDHFRGFESYYS
ILAADKTAANGEWVKGPGLSFINAVNKQLPGAAIIAEDLGYLTPEVKALLKASGYPGMKV
LQFAFDSRESGDYMPHSYIRNCVVYTGTHDNTTSMDWFKSAPPEDAKLALDYFGLKSSKD
GNWAYIRTALSCVADLAVIPLQDYLGLGKQGRMNAPSTLGGNNWCWRLLPGQIESELAVK
IKRITDICGR
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggaaagagcagcagggatcttgttggccgtaagcagtttgccttctccctatgggatt
ggttcttttggaacagcaggcagggagtggtgcgatttcctcgccaaagcaggccagaaa
tactggcagattctgccccttggccccaccggctggggcaacagcccctatcagagtttt
tcagcttttgctgtttcttcctattatatagacctcgacaccctcgccagcgaaggactt
cttaaaaaaggggaggccgaaaagatagtctggggttcaaggcccggctctgtaaactac
ggcgccctttatcaccggagggaaaaaattctgcgccttgctttcgagaagttcaggctt
gtcaaagccttcaaggactttagggagaagaacgctttttggctcgaagattacagcctc
tttatggcattgaaaaaagcgaaccagggaaaggcatggctcgattgggaagaaggcttg
cggtttcgcaaaaaggatgctcttgccaaggcgagggaagattatatagaagaaattgat
tatcacgtgtttgtgcagtaccaggctttccgccaatggtcagctttgaagcactacgcc
aatagccggggcatatccattatcggggatatgcctatctatgtgtccatggatagttcc
gacacctgggccaacagcgatcttttccagctcgacaaggatctgcgccccatccgtgtt
tccggctgcccgccggacccctttgccgcagacggccagctctgggggaaccctctctac
cgctgggattatatcaggaaaaccaactttgcctggtggatactgcggctccgcgaaagc
ctttcgctttacgatgtggtgcgcatagaccacttccggggcttcgagagttattactct
atcctcgcagccgacaagaccgcagctaacggcgagtgggtcaaaggcccgggcctttcg
tttatcaacgccgtaaacaagcagctccccggcgctgccataatcgccgaggatcttggc
tacctcaccccggaggtcaaagccctgctcaaagcctcgggctacccaggcatgaaggtg
ctccagttcgcctttgactccagggagtcaggggattatatgccccattcatacatacgc
aattgcgtggtttacaccggtacccatgacaacactacttccatggactggtttaaatcc
gcgccgcctgaagatgccaaactagccctggattacttcggccttaaatcaagcaaggac
ggaaactgggcttatatccgtaccgccctttcctgtgttgccgacctcgcggttatcccc
ctgcaggattatcttggcctgggcaagcaggggcgcatgaatgcgccctctaccctgggt
ggcaacaactggtgctggcgattgctccccgggcaaatcgaatcggaacttgcggtgaaa
attaagcgtattacggatatttgcggaaggtga

DBGET integrated database retrieval system