KEGG   Treponema azotonutricium: TREAZ_1811Help
Entry
TREAZ_1811        CDS       T01506                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
taz  Treponema azotonutricium
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:taz00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
554033..555505
Genome map
AA seq 490 aa AA seqDB search
MERAAGILLAVSSLPSPYGIGSFGTAGREWCDFLAKAGQKYWQILPLGPTGWGNSPYQSF
SAFAVSSYYIDLDTLASEGLLKKGEAEKIVWGSRPGSVNYGALYHRREKILRLAFEKFRL
VKAFKDFREKNAFWLEDYSLFMALKKANQGKAWLDWEEGLRFRKKDALAKAREDYIEEID
YHVFVQYQAFRQWSALKHYANSRGISIIGDMPIYVSMDSSDTWANSDLFQLDKDLRPIRV
SGCPPDPFAADGQLWGNPLYRWDYIRKTNFAWWILRLRESLSLYDVVRIDHFRGFESYYS
ILAADKTAANGEWVKGPGLSFINAVNKQLPGAAIIAEDLGYLTPEVKALLKASGYPGMKV
LQFAFDSRESGDYMPHSYIRNCVVYTGTHDNTTSMDWFKSAPPEDAKLALDYFGLKSSKD
GNWAYIRTALSCVADLAVIPLQDYLGLGKQGRMNAPSTLGGNNWCWRLLPGQIESELAVK
IKRITDICGR
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggaaagagcagcagggatcttgttggccgtaagcagtttgccttctccctatgggatt
ggttcttttggaacagcaggcagggagtggtgcgatttcctcgccaaagcaggccagaaa
tactggcagattctgccccttggccccaccggctggggcaacagcccctatcagagtttt
tcagcttttgctgtttcttcctattatatagacctcgacaccctcgccagcgaaggactt
cttaaaaaaggggaggccgaaaagatagtctggggttcaaggcccggctctgtaaactac
ggcgccctttatcaccggagggaaaaaattctgcgccttgctttcgagaagttcaggctt
gtcaaagccttcaaggactttagggagaagaacgctttttggctcgaagattacagcctc
tttatggcattgaaaaaagcgaaccagggaaaggcatggctcgattgggaagaaggcttg
cggtttcgcaaaaaggatgctcttgccaaggcgagggaagattatatagaagaaattgat
tatcacgtgtttgtgcagtaccaggctttccgccaatggtcagctttgaagcactacgcc
aatagccggggcatatccattatcggggatatgcctatctatgtgtccatggatagttcc
gacacctgggccaacagcgatcttttccagctcgacaaggatctgcgccccatccgtgtt
tccggctgcccgccggacccctttgccgcagacggccagctctgggggaaccctctctac
cgctgggattatatcaggaaaaccaactttgcctggtggatactgcggctccgcgaaagc
ctttcgctttacgatgtggtgcgcatagaccacttccggggcttcgagagttattactct
atcctcgcagccgacaagaccgcagctaacggcgagtgggtcaaaggcccgggcctttcg
tttatcaacgccgtaaacaagcagctccccggcgctgccataatcgccgaggatcttggc
tacctcaccccggaggtcaaagccctgctcaaagcctcgggctacccaggcatgaaggtg
ctccagttcgcctttgactccagggagtcaggggattatatgccccattcatacatacgc
aattgcgtggtttacaccggtacccatgacaacactacttccatggactggtttaaatcc
gcgccgcctgaagatgccaaactagccctggattacttcggccttaaatcaagcaaggac
ggaaactgggcttatatccgtaccgccctttcctgtgttgccgacctcgcggttatcccc
ctgcaggattatcttggcctgggcaagcaggggcgcatgaatgcgccctctaccctgggt
ggcaacaactggtgctggcgattgctccccgggcaaatcgaatcggaacttgcggtgaaa
attaagcgtattacggatatttgcggaaggtga

DBGET integrated database retrieval system