KEGG   Treponema azotonutricium: TREAZ_1843Help
Entry
TREAZ_1843        CDS       T01506                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
taz  Treponema azotonutricium
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:taz00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    TREAZ_1843
Enzymes [BR:taz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     TREAZ_1843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(516907..518958)
Genome map
AA seq 683 aa AA seqDB search
MEKILQGNKITLGTCYYPEHWDESLWKDDLRRMKENGINAIRIAEFAWNKFESAEGNFNF
GFFDRFLETAKSADISVIFCTPTATPPAWLTNEYPEVLNSRIDGTLLRHGARRHYNYNSP
VYRRFTERLVEKIAEHYGKHPAIIGWQIDNEINCETDEFYSDSDTIAFREFLKTKYTTLD
ALNSAWGTVFWNQTYTAWAEVYVPRPTISDSVNPHEVLDYIRFVSQSARGYIKLQSDIIR
KYIKPGDFITTNGMFSSLDNHAMNKESLDFYTYDSYPNFAYCLGTDPEHSADLNDRKWSR
NLTEVRSISPDKFGIMEQQSGPNGWNTRMEAPSPRPGQMTLWTMQSIAHGADYVGYFRWR
TCTMGTEIYWHGILDYSNRDNRRLAEVNDIWKKTQKISAIAGSKYQAAFGILKDYDNAWD
AKLDKWHWRVDKESEAGIFQAAQLTHTPFDYVYINDDSSAEILSPYPVLFYPHAVIMTEK
RAKLIENYVESGGTLILGCRTGYKDITGKCPMHKLPGLLQKISGADIVDYGFVSPDDGKV
TVDWEGTEIEASVFNDIAEPLEQAKILGTFKNAYFAGKGGLIYNEYGKGRVFYFGGAFNQ
GAAKIFLSKLKIANPYGGLIDAPESCEIACRASSSKQYLFVLNYTRKPAQITLKKEMQDM
YSGTKVSGTVELAAYGTAVYEIK
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaatactgcaaggaaataaaataaccctcggcacttgttactatcctgaacac
tgggacgagagcctctggaaggatgatctcaggcgcatgaaagaaaacggtatcaacgca
atcaggattgcggaatttgcatggaacaaatttgagagtgccgaggggaactttaatttt
ggtttctttgaccgctttcttgaaaccgctaaatctgctgacatatcggtaattttctgc
acacccacagcaacgccccctgcctggcttaccaatgaatatccggaagtactcaacagc
cggatagacggcacgcttttaaggcatggcgcccgcaggcactataattacaattcacct
gtgtaccgccgctttacagaacggcttgtggaaaaaatagccgaacattatggcaaacat
ccggcaatcattggctggcagatagacaatgagattaattgcgaaaccgacgaattctac
tcggacagcgatactattgccttccgggaattcctcaaaacgaaatatacaaccctcgac
gccctcaattccgcatggggaacagtcttctggaaccagacctataccgcttgggccgag
gtgtatgtccccaggccgacaatcagcgattccgttaaccctcacgaggtacttgattac
atacgttttgtttcgcagagcgcacggggttatataaagctgcagagcgatataatccgc
aaatatataaaaccgggcgattttattaccacaaatggtatgttcagcagcctcgataat
cacgcaatgaacaaggagagtttggatttctacacttacgactcctatccgaattttgcc
tattgccttggaacagatcctgaacattctgccgatttgaacgatcgcaaatggagcagg
aaccttactgaagtccgttcaatttcgccggacaaattcggcatcatggaacagcagtca
gggcccaacggctggaatacaaggatggaagctccctccccccggccaggccagatgacg
ctctggacaatgcagagcattgcccatggagcggattatgtcggttatttccgctggcgt
acctgcacgatgggaactgaaatctactggcacggtattctcgattattccaaccgtgac
aacaggcgccttgccgaagtcaatgatatttggaagaagacacagaaaatttcggccatt
gcggggagcaaataccaggcggcctttggcatattaaaagattacgacaatgcatgggac
gccaaactggacaagtggcactggcgggtggacaaagaaagcgaagcgggtatcttccag
gcagcccaattgacccataccccctttgattacgtgtatataaacgacgattcttccgca
gaaatactgtcgccctatccggtgctcttttatccccatgcggtaataatgacagaaaaa
cgtgccaaactgattgaaaactatgtggaatccggcggcactctcattcttggctgcaga
acgggttacaaagacattacaggtaaatgccccatgcacaagcttccgggtttgctgcaa
aaaatatcgggggctgatattgttgattacggctttgtttctcctgatgatggcaaagtc
actgttgactgggaaggcacagaaattgaagcctctgtattcaacgatattgctgaaccg
cttgagcaggcaaaaattcttggcacattcaagaatgcatatttcgccggcaagggaggg
ctcatatacaatgaatacggcaagggcagggtcttttattttggcggcgcctttaaccag
ggggcggcgaagatatttctttccaagctgaaaatagccaatccctatggcggactaatt
gatgccccggaaagctgtgaaattgcctgtcgtgcttcaagcagcaaacagtatcttttt
gtgcttaattataccaggaagcctgcacagataaccttgaaaaaggagatgcaggatatg
tattcaggcacaaaggtttccggtactgtggaacttgcggcttatggaacagctgtttat
gagataaagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system