KEGG   Treponema azotonutricium: TREAZ_1898Help
Entry
TREAZ_1898        CDS       T01506                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
taz  Treponema azotonutricium
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:taz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TREAZ_1898
   01230 Biosynthesis of amino acids
    TREAZ_1898
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TREAZ_1898
   00030 Pentose phosphate pathway
    TREAZ_1898
   00051 Fructose and mannose metabolism
    TREAZ_1898
   00052 Galactose metabolism
    TREAZ_1898
  Energy metabolism
   00680 Methane metabolism
    TREAZ_1898
Enzymes [BR:taz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TREAZ_1898
Protein phosphatases and associated proteins [BR:taz01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TREAZ_1898
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
462380..463723
Genome map
AA seq 447 aa AA seqDB search
MADAIDFTIEELGKRSIKSPIAMSTVRGDMIANYVTDDQFLRYNTEVKVGPQPPLKRSQI
IECAGPREMIYFTPAHVHAGIVSCGGLCPGINDVIRSIVRCLWYRYGVKRISGIQYGYKG
FLPEYQFGVTQLDPDKVDEIHKLGGTYLGSARGGGKEVGKIVDAIEQLNLNMLFTIGGDG
TQHGTLDIADEIEKRHLKIALIGIPKTVDNDFSLIQKSFGFDTAVDKAVEVVAAAHMEAR
SAINGIGLVKVMGRESGFIAAHTALASHEVNFVLIPEVPFNLEGYNGFLTHLEKRIVSRH
HAVIIVAEGAMQDQLITDKQLDAGGNLKYADVGTYLRDRITKYFAEKKIEINLKYIDPSY
IIRSAPANPADSIYCERLGNAAVHAAMAGKTRLIIGLVNNEFVHLPIKTVISTRNHVDPE
GNLWRDTLDATHQPALMVNQFGDGKAK
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggccgatgctattgattttactattgaagaattgggaaagcgcagcataaagtcgccc
attgccatgtccactgtacgtggggatatgatagccaactatgtaacggatgatcaattt
ttacgttataatacggaggtaaaagtaggccctcagccgccccttaagcgatcccagatt
atagaatgtgccggtcccagggaaatgatctattttacccctgcccatgtgcatgcaggc
atcgtaagctgcggcggcctttgccctggcattaacgacgtgatccgctccattgtgcgc
tgcctgtggtaccgctatggggtaaagaggatttcgggaatacagtacgggtataagggt
ttcctcccggaataccaattcggcgtaacccaattggaccccgacaaggtggatgagatt
cacaagctcgggggtacgtaccttggaagcgcccggggcggcggcaaagaggtggggaag
attgtggatgccatagaacagcttaatctcaatatgctctttaccataggtggtgacggc
acccagcatggcaccctggacattgccgacgaaatcgaaaaacgacaccttaagatcgcc
ctgattggcattcccaagactgttgacaatgacttctccctcatccagaaatcctttggt
ttcgatactgccgttgacaaggcggtggaagttgttgcggctgcccacatggaagcccgc
tccgccataaacggcataggccttgtaaaggtcatgggccgtgaatcgggcttcatcgcc
gcgcacaccgcccttgcaagccacgaggtcaactttgtgctcattcccgaagtgcccttc
aaccttgagggctataacggtttccttacccaccttgagaagcgcattgtaagccgtcac
cacgcggtgattatcgtggccgaaggagccatgcaggatcagcttatcactgataaacag
cttgacgccggcggaaaccttaaatacgccgatgtgggtacctatctccgggacaggatc
accaagtactttgctgaaaagaagattgagatcaatctcaagtacatcgatcccagctac
attatccgctctgcccctgccaaccctgccgattccatctactgcgaaaggctggggaac
gctgcggtgcatgcggccatggccggcaagaccaggctcatcatcggcctggtgaacaat
gaatttgtccaccttcccatcaagacggttatttccaccaggaaccatgtagaccccgag
ggcaacctttggcgggacaccctggatgctacccatcagccggctctcatggtgaaccaa
ttcggcgatggcaaagctaaataa

DBGET integrated database retrieval system