KEGG   Treponema azotonutricium: TREAZ_2006Help
Entry
TREAZ_2006        CDS       T01506                                 

Definition
(GenBank) aldehyde-alcohol dehydrogenase 2
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
taz  Treponema azotonutricium
Pathway
taz00010  Glycolysis / Gluconeogenesis
taz00071  Fatty acid degradation
taz00350  Tyrosine metabolism
taz00620  Pyruvate metabolism
taz00625  Chloroalkane and chloroalkene degradation
taz00626  Naphthalene degradation
taz00650  Butanoate metabolism
taz01100  Metabolic pathways
taz01110  Biosynthesis of secondary metabolites
taz01120  Microbial metabolism in diverse environments
taz01130  Biosynthesis of antibiotics
taz01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:taz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TREAZ_2006
   00620 Pyruvate metabolism
    TREAZ_2006
   00650 Butanoate metabolism
    TREAZ_2006
  Lipid metabolism
   00071 Fatty acid degradation
    TREAZ_2006
  Amino acid metabolism
   00350 Tyrosine metabolism
    TREAZ_2006
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    TREAZ_2006
   00626 Naphthalene degradation
    TREAZ_2006
Enzymes [BR:taz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     TREAZ_2006
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     TREAZ_2006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AEF83027
UniProt: F5YA51
Position
368078..370699
Genome map
AA seq 873 aa AA seqDB search
MAETKKYETVNSPETLEKALAGIRAAQKIYAAFTQEQVDRIFFAAACAADRARIKLAKMA
VEETGMGIVEDKVIKNHYAAEYIYNAYKNTKTCGIIEEDAAYGIKKIAEPIGLIAAVIPT
TNPTSTAIFKTLICLKTRNGIIISPHPRAKGSTNAAARIVLDAAVAAGAPEGLIRWIDEP
SLEMTNTVMKEADTILATGGPGMVKSAYSSGKPAIGVGSGNVPAVIDSSADVILAVNSII
HSKTFDNGMICASEQSVIVLDDVYDAVKKEFQARGCHFLSAADTEKVRKTIIINGALNAK
IVGQKAHTIAALAGVKVPEATKIIIGEVKSVDISEEFAHEKLSPVLGMYKAKTFGEALDK
AEQLIRDGGYGHTASLYLNTVTDKAKIDEFASRMKTCRIIVNTPSSHGGIGDLYNFKLAP
SLTLGCGSWGGNSVSENVGVKHLMNIKTVAERRENMLWFRAPEKIYIKKGCLPVALDELK
NVLGKKRVYIVTDNFLYKNGYTKAITGKLDEMGIVHETFFDVEPDPTLACAKKGAALMTA
FQPDCIIALGGGSAMDAGKIMWVLYEHPEADFQDMAMRFIDIRKRVYTFPKMGEKAYFIA
VPTSAGTGSEVTPFAVITDEKIGMKYPLADYELMPDMAIVDADLMMNAPKGLTSASGIDA
LTHDLEAYASMLATDYTDGLALRSMQMIFKYLPAAYNNGANDAIAREKMANAATMAGMAF
ANAFLGVCHSMAHKLGAFHHLPHGIANALLINEVLRFNAVEVPPKMGTFSQYDHPHTLAR
YVEIADFLGLKGKTDGEKLDSLIAAIDKLKSAIGIKKTIKDYNIDEKDFLARLDEMSEQA
FDDQCTGANPRYPLIAEIRQMYLNAYYGKGEKA
NT seq 2622 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaacaaaaaagtacgagacggtcaacagtccggagacgctggaaaaggctctg
gcgggtatacgggcggcgcagaaaatctacgctgcttttacccaggagcaggtggacagg
attttctttgctgcggcctgcgctgcggaccgggcgcggatcaagctggcaaagatggcg
gtggaagaaaccggcatgggcattgtcgaagacaaggtgattaaaaaccactatgcggcg
gaatacatatacaatgcttacaaaaacaccaaaacctgcggtattatcgaagaggatgcg
gcttatggaatcaagaagattgccgaacccattgggcttatagcggcggttatccccact
accaatcctacctccacagcgattttcaaaaccctcatctgccttaagacccgcaatggg
attatcatttccccccaccccagggcaaagggcagcacaaatgcggcggccaggattgtg
ctggacgcggcagtcgcggcgggcgcccccgaggggcttatacgctggatagacgagccg
agcctcgaaatgaccaatacggtaatgaaagaggcggataccatcctcgccaccggaggg
ccgggcatggtgaagtcggcctattcttcgggcaagccggctatcggcgttggttcaggc
aatgtcccggctgtcatcgattcaagtgccgatgtgattttggcggttaattcaataatc
cattccaagacctttgacaacggcatgatttgcgcatcggaacaatcggtaattgtgctg
gacgatgtgtatgacgcggtgaaaaaagaattccaggcccggggctgccatttcctcagt
gcggcggatacagaaaaagtgcggaagaccattatcattaatggcgcgcttaatgccaaa
atcgtagggcagaaggcccacactatagcggctcttgcaggggtgaaagtcccggaagct
acaaaaataattatcggcgaagttaaaagtgttgatatcagcgaggaatttgcccacgaa
aaactttcgcctgtgctgggcatgtacaaggccaagacattcggcgaagccctggacaag
gctgaacagcttatccgcgacggcggttacggccataccgcatccctttaccttaacacg
gttaccgataaagccaagatcgatgaatttgcttcccgcatgaagacctgccgcatcatt
gtgaataccccgtcttcccacggcggtatcggggatctgtacaacttcaagcttgcgccg
tcccttaccctgggatgcggttcatggggcgggaactcggtttccgaaaatgtgggagta
aaacacttaatgaacattaaaactgttgctgaaaggagggagaacatgctctggttcagg
gctcctgaaaagatctatataaagaaaggctgcctcccggttgccctggatgaacttaaa
aatgtgctgggcaaaaaacgggtatatatcgttaccgataacttcctctacaaaaacgga
tacaccaaagccatcaccggcaagctcgacgaaatgggaatcgtccacgagaccttcttt
gacgtggagcctgacccgactctggcctgcgcgaagaaaggcgccgccctgatgacggca
ttccagcctgactgcattatcgccctgggcggcggttccgccatggacgccggcaaaatc
atgtgggtcctctacgaacaccccgaagccgacttccaggatatggccatgcgctttatc
gacatacgcaagcgtgtctacaccttccccaaaatgggcgaaaaagcctactttatcgcg
gttcctacttcggcggggacgggcagcgaagtaacgccttttgcggttatcacggatgaa
aaaatcggcatgaagtaccctctggcggattatgaactcatgccggatatggcaattgta
gatgcggacttgatgatgaacgcgcccaaggggctcaccagcgcatcgggaatcgacgcg
ctcacccacgacctggaggcttatgcttccatgcttgccacggattataccgacgggctg
gccctcaggtccatgcagatgatcttcaaatatctgcccgcggcgtacaataatggcgcc
aacgatgctattgcccgtgaaaagatggctaacgctgcaaccatggcgggtatggctttt
gccaacgcattcctcggcgtgtgccattccatggcgcataagctcggggcttttcatcat
cttccccacggtattgcaaatgcccttttgataaacgaggtgctgcgctttaacgctgtg
gaagtaccgcccaagatggggactttttcccagtacgatcacccccataccctggcccgc
tatgttgagatcgccgacttccttggccttaaaggaaaaactgatggggaaaaacttgac
agtcttattgcggcaattgataagcttaaatccgcgataggaatcaaaaagacaattaag
gattacaacatcgacgaaaaagattttcttgcccgcctggacgaaatgagcgagcaggct
tttgacgatcaatgcactggcgctaacccgcgctatcctttaattgcagaaatcaggcag
atgtaccttaacgcctattacgggaaaggggagaaagcatga

DBGET integrated database retrieval system