KEGG   Treponema azotonutricium: TREAZ_2052Help
Entry
TREAZ_2052        CDS       T01506                                 

Definition
chemotaxis response regulator protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
taz  Treponema azotonutricium
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:taz00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    TREAZ_2052
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    TREAZ_2052
Enzymes [BR:taz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     TREAZ_2052
Two-component system [BR:taz02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   TREAZ_2052
Bacterial motility proteins [BR:taz02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    TREAZ_2052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(318757..319899)
Genome map
AA seq 380 aa AA seqDB search
MADEVSVLIVDDSALMRNLIGRMVEDTPGLVIADKAMNGVFALQKIPRVNPDVIVLDLEM
PEMNGIEFLKERKKRNIQIPVVILSSIAARGAEITMEALALGASDFIQKPSGSVSEDIHT
VRDTLVTMLLGYGGSFRRSQGRKVLSPSEYTKKPEHVGVGPDIATLLGLSGTPAAGPAKP
PAQIRKPGKTEIIALGISTGGPDALRVVFANLDKDLAVPIVVVQHMPPGFTNEFAKSLDR
LCPLDVKEAEEGDAIKPGRILIAQGNKHLEVEKKATGSIVHLTSTPQVSGHRPSADVLFA
SVALAYQNHALGVIMTGMGRDGAAQIGTIYKEGGMTIGQDEATAVVYGMPRVAYELGHVM
EQVSLQNMGRRICEIAKAVR
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
gtggctgatgaagtatcggttttgattgttgacgactctgcgttgatgcggaatctcatt
ggcaggatggtggaagacacgccgggcctggtgatagctgacaaagccatgaacggtgta
ttcgcgcttcagaagataccccgggttaaccctgacgttatcgttctggatctggagatg
cccgaaatgaacggcatcgaattcctcaaggaacggaagaagcggaacatccagatccct
gtggtcatcctttcatccattgctgccaggggtgccgaaatcaccatggaagcccttgcc
cttggggcgagcgactttatccagaagccttcgggctcggtttcagaagatattcacact
gtcagggataccctggtaaccatgctcctggggtatggcggctctttccgccgcagccag
ggacgcaaggtgctttcgccttccgaatacaccaaaaagcccgagcacgtgggagtgggg
cccgatatcgccaccctccttgggctgagcggaacccctgccgcaggccctgccaagcct
cctgcccagatacgcaaacccggcaagaccgagatcatcgccctgggcatttccacaggc
gggcctgacgccctgcgggtggtctttgccaaccttgacaaagacctcgccgtccccatc
gtggtagtccagcacatgcccccggggttcaccaacgaatttgccaagagcctcgacagg
ctctgccccctcgatgtcaaagaggccgaagagggcgacgccattaagcctggccgcatc
ctcattgcccagggcaacaagcacctcgaggtggagaaaaaagccaccggcagcattgtc
catcttacaagcactccccaggtttcgggccaccggccttctgcggacgtgctctttgcc
tcggtcgccctcgcctaccagaaccatgccctcggcgtgatcatgaccggcatgggccgc
gacggcgctgcccagattggcaccatctacaaagaaggcggcatgaccataggccaggac
gaggccactgcggttgtgtacggcatgccccgggtagcctacgagcttggccatgtcatg
gaacaggtttcgctccagaacatgggccgcaggatctgcgagatagcgaaagcggtaagg
taa

DBGET integrated database retrieval system