KEGG   Treponema azotonutricium: TREAZ_2052Help
Entry
TREAZ_2052        CDS       T01506                                 

Definition
chemotaxis response regulator protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
taz  Treponema azotonutricium
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:taz02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:taz02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(318757..319899)
Genome map
AA seq 380 aa AA seqDB search
MADEVSVLIVDDSALMRNLIGRMVEDTPGLVIADKAMNGVFALQKIPRVNPDVIVLDLEM
PEMNGIEFLKERKKRNIQIPVVILSSIAARGAEITMEALALGASDFIQKPSGSVSEDIHT
VRDTLVTMLLGYGGSFRRSQGRKVLSPSEYTKKPEHVGVGPDIATLLGLSGTPAAGPAKP
PAQIRKPGKTEIIALGISTGGPDALRVVFANLDKDLAVPIVVVQHMPPGFTNEFAKSLDR
LCPLDVKEAEEGDAIKPGRILIAQGNKHLEVEKKATGSIVHLTSTPQVSGHRPSADVLFA
SVALAYQNHALGVIMTGMGRDGAAQIGTIYKEGGMTIGQDEATAVVYGMPRVAYELGHVM
EQVSLQNMGRRICEIAKAVR
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
gtggctgatgaagtatcggttttgattgttgacgactctgcgttgatgcggaatctcatt
ggcaggatggtggaagacacgccgggcctggtgatagctgacaaagccatgaacggtgta
ttcgcgcttcagaagataccccgggttaaccctgacgttatcgttctggatctggagatg
cccgaaatgaacggcatcgaattcctcaaggaacggaagaagcggaacatccagatccct
gtggtcatcctttcatccattgctgccaggggtgccgaaatcaccatggaagcccttgcc
cttggggcgagcgactttatccagaagccttcgggctcggtttcagaagatattcacact
gtcagggataccctggtaaccatgctcctggggtatggcggctctttccgccgcagccag
ggacgcaaggtgctttcgccttccgaatacaccaaaaagcccgagcacgtgggagtgggg
cccgatatcgccaccctccttgggctgagcggaacccctgccgcaggccctgccaagcct
cctgcccagatacgcaaacccggcaagaccgagatcatcgccctgggcatttccacaggc
gggcctgacgccctgcgggtggtctttgccaaccttgacaaagacctcgccgtccccatc
gtggtagtccagcacatgcccccggggttcaccaacgaatttgccaagagcctcgacagg
ctctgccccctcgatgtcaaagaggccgaagagggcgacgccattaagcctggccgcatc
ctcattgcccagggcaacaagcacctcgaggtggagaaaaaagccaccggcagcattgtc
catcttacaagcactccccaggtttcgggccaccggccttctgcggacgtgctctttgcc
tcggtcgccctcgcctaccagaaccatgccctcggcgtgatcatgaccggcatgggccgc
gacggcgctgcccagattggcaccatctacaaagaaggcggcatgaccataggccaggac
gaggccactgcggttgtgtacggcatgccccgggtagcctacgagcttggccatgtcatg
gaacaggtttcgctccagaacatgggccgcaggatctgcgagatagcgaaagcggtaagg
taa

DBGET integrated database retrieval system