KEGG   Treponema azotonutricium: TREAZ_2054Help
Entry
TREAZ_2054        CDS       T01506                                 

Definition
hypothetical protein
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
taz  Treponema azotonutricium
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:taz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TREAZ_2054
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TREAZ_2054
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TREAZ_2054
Enzymes [BR:taz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TREAZ_2054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
316557..317945
Genome map
AA seq 462 aa AA seqDB search
MAKKIPTRLYLSEDEIPRFWYNLRADMKAKPDPLLHPGTLKPATAQDLEAVFCKEPVKQE
LDDSTRLIPIPEALEEFYLSYRPAPLIRAYFLEKALGTPAEIYYKFEGTNTSGSHKLNSA
AAQAYYAKEEGLTSVTTETGAGQWGTAMAMAAGYYGLGLTVYMVKVSSEQKPYRKALIET
YGAKLIPSPSNTTESGRKILEKDPDTGGSLGCAISEAVEQAVKTDKCRYVLGSVMNHVVL
HQSIIGQETKAALDKYGIKPDIIIGCAGGGSNLGGLIAPFMGEKLLGKSNANTRFIAVEP
ASCPSFTRGRYAYDFGDTARTTPLIRMMTLGNGFIPSANHAGGLRYHGMNPILSKLYKDG
LIEARSAVQSEVFDAAVQFMKVEGILPAPESSHAIKAAIDEALECKRTKEKKVIVFGLTG
TGYFDLTAYIAYNNKTMTDYIPTDEDLAKGFSSIPDIPQNKD
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaaaatccccacccgcctctacctttccgaggacgagatcccccggttctgg
tacaacctccgggcggacatgaaggcaaaacccgatcccctactgcatcccggaacccta
aagccagccactgcccaagaccttgaggcggtattctgcaaggagccggtaaaacaggag
ctggacgacagtacccgcctcatccccatccccgaagctcttgaggagttctacctttcc
tacaggcccgcgccccttatcagggcttatttcctagaaaaagccctggggacaccggcg
gaaatttactacaaatttgaaggaaccaatacctcggggagccacaaactcaattctgcg
gcagcccaggcctattacgccaaagaggaaggtctcacttcggtaactaccgagaccggc
gccggccagtggggcacggccatggccatggcggctgggtactatggcctgggcctcact
gtgtacatggtcaaagtgagttcagagcagaagccctaccgcaaggccctgatagaaacc
tacggggcaaaactcatcccctcgccttcaaacaccaccgaatcgggcaggaagatactg
gaaaaagaccccgacaccgggggcagcctgggctgcgcgatttccgaggcagtggagcag
gcggtaaaaaccgacaagtgccgttatgtgctgggcagcgtgatgaaccacgtggtactc
caccagtccatcatcgggcaggaaaccaaggccgccctggacaaatacggcataaagccc
gacatcatcatcggatgcgccgggggcggttccaatctcggcggccttatcgcgcctttt
atgggcgaaaaactcctgggcaagtcaaacgccaatacccgcttcatcgccgtggaaccc
gcgtcatgccccagctttacccgtggccgctatgcctacgattttggcgacaccgccagg
accactccccttatccgcatgatgaccctgggcaacggctttatcccttcggccaaccac
gcagggggcctccgctaccacggcatgaaccccatcctgagcaagctctacaaagacgga
ctcatcgaggcgcgctcggcagtgcagagcgaagtctttgacgcggcagtgcaattcatg
aaggttgaaggaatactgcctgccccggaatcgtcccacgcgatcaaggcggccattgac
gaagccctggagtgtaaaagaacaaaggaaaagaaggtgatagtcttcggccttaccggt
acgggctactttgaccttaccgcctacattgcctacaacaacaagaccatgacggactat
atccccacagacgaagatttggcaaaaggcttttcgagcattccggacattccgcagaat
aaggattaa

DBGET integrated database retrieval system