KEGG   Treponema azotonutricium: TREAZ_2054Help
Entry
TREAZ_2054        CDS       T01506                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
taz  Treponema azotonutricium
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:taz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TREAZ_2054
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TREAZ_2054
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TREAZ_2054
Enzymes [BR:taz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TREAZ_2054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
316557..317945
Genome map
AA seq 462 aa AA seqDB search
MAKKIPTRLYLSEDEIPRFWYNLRADMKAKPDPLLHPGTLKPATAQDLEAVFCKEPVKQE
LDDSTRLIPIPEALEEFYLSYRPAPLIRAYFLEKALGTPAEIYYKFEGTNTSGSHKLNSA
AAQAYYAKEEGLTSVTTETGAGQWGTAMAMAAGYYGLGLTVYMVKVSSEQKPYRKALIET
YGAKLIPSPSNTTESGRKILEKDPDTGGSLGCAISEAVEQAVKTDKCRYVLGSVMNHVVL
HQSIIGQETKAALDKYGIKPDIIIGCAGGGSNLGGLIAPFMGEKLLGKSNANTRFIAVEP
ASCPSFTRGRYAYDFGDTARTTPLIRMMTLGNGFIPSANHAGGLRYHGMNPILSKLYKDG
LIEARSAVQSEVFDAAVQFMKVEGILPAPESSHAIKAAIDEALECKRTKEKKVIVFGLTG
TGYFDLTAYIAYNNKTMTDYIPTDEDLAKGFSSIPDIPQNKD
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaaaatccccacccgcctctacctttccgaggacgagatcccccggttctgg
tacaacctccgggcggacatgaaggcaaaacccgatcccctactgcatcccggaacccta
aagccagccactgcccaagaccttgaggcggtattctgcaaggagccggtaaaacaggag
ctggacgacagtacccgcctcatccccatccccgaagctcttgaggagttctacctttcc
tacaggcccgcgccccttatcagggcttatttcctagaaaaagccctggggacaccggcg
gaaatttactacaaatttgaaggaaccaatacctcggggagccacaaactcaattctgcg
gcagcccaggcctattacgccaaagaggaaggtctcacttcggtaactaccgagaccggc
gccggccagtggggcacggccatggccatggcggctgggtactatggcctgggcctcact
gtgtacatggtcaaagtgagttcagagcagaagccctaccgcaaggccctgatagaaacc
tacggggcaaaactcatcccctcgccttcaaacaccaccgaatcgggcaggaagatactg
gaaaaagaccccgacaccgggggcagcctgggctgcgcgatttccgaggcagtggagcag
gcggtaaaaaccgacaagtgccgttatgtgctgggcagcgtgatgaaccacgtggtactc
caccagtccatcatcgggcaggaaaccaaggccgccctggacaaatacggcataaagccc
gacatcatcatcggatgcgccgggggcggttccaatctcggcggccttatcgcgcctttt
atgggcgaaaaactcctgggcaagtcaaacgccaatacccgcttcatcgccgtggaaccc
gcgtcatgccccagctttacccgtggccgctatgcctacgattttggcgacaccgccagg
accactccccttatccgcatgatgaccctgggcaacggctttatcccttcggccaaccac
gcagggggcctccgctaccacggcatgaaccccatcctgagcaagctctacaaagacgga
ctcatcgaggcgcgctcggcagtgcagagcgaagtctttgacgcggcagtgcaattcatg
aaggttgaaggaatactgcctgccccggaatcgtcccacgcgatcaaggcggccattgac
gaagccctggagtgtaaaagaacaaaggaaaagaaggtgatagtcttcggccttaccggt
acgggctactttgaccttaccgcctacattgcctacaacaacaagaccatgacggactat
atccccacagacgaagatttggcaaaaggcttttcgagcattccggacattccgcagaat
aaggattaa

DBGET integrated database retrieval system