KEGG   Treponema azotonutricium: TREAZ_2217Help
Entry
TREAZ_2217        CDS       T01506                                 

Definition
phosphoenolpyruvate mutase
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
taz  Treponema azotonutricium
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:taz00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    TREAZ_2217
Enzymes [BR:taz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     TREAZ_2217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(125737..127035)
Genome map
AA seq 432 aa AA seqDB search
MKTIYLGLRGDIIHPGIINIIREAQKHGQVLVGLLTDSAIAAHKRLPYLTWEQRLEVVEN
IKGVSRVVPQEEWSYVPNLKKYKPDAIIHGDDWKSGPLSKERGHVYAAMQELGGEVIEIP
YTQGVNSSALSEAMRAIGTTPDIRLKTLRRLLEIKPIVRIMEAHSGLSGLIIENLEIQSE
DGLRSFDGMWSSSLTDSASKGKPDIEAVDLTTRMQDLTNILECTTKPIIFDGDTGGKSEH
FVFTVRTLERNGISAVIIEDKIGLKKNSLFGTDVIQELCPIPEFCEKISAGKRAQVTRDF
MIIARLESLIAGFPVSDALERARAFVAAGADGIMIHSKEKSGSDIREFCLKFRAEYEKVP
LVLVPTSYNQFLEKELCQWGASIIIYANHMLRASYPAMMNAARTILENERALEADKLCMP
IKEILELIPGGK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaatttatttggggcttcggggcgatatcatccacccgggcatcatcaacatt
atcagggaagctcaaaaacacgggcaggtacttgtgggcctcctcacagattctgcaatt
gccgcccacaaacgcctcccctacctcacctgggaacagcgtctcgaagtggtagagaac
atcaagggcgtatccagggtagtaccccaggaagaatggagctatgtacccaatctgaaa
aagtataaacccgatgccattatccacggcgatgattggaaatcgggtcccttgagtaaa
gagcgcggccatgtctatgcagcaatgcaggaactgggcggtgaagttatcgagatcccc
tacacccagggtgtgaactcctcagctttaagcgaagccatgcgcgccataggcaccacc
ccggatatcaggcttaaaacattacggcgtctcctcgaaataaaaccaatagtacgaatt
atggaggcccactcgggcctctcgggtctcatcatcgaaaacctcgaaatccaaagcgaa
gacggcctccgcagttttgacggtatgtggtcatcaagcctcaccgactccgccagcaag
ggtaagcccgatatcgaagccgttgacctcactacccgtatgcaggatctcaccaatatc
ctcgaatgtactaccaagcccatcatctttgacggcgacacaggcggcaagagcgaacac
ttcgtgtttactgtccgtaccctggaacggaacggtatttcggcagttatcatcgaagat
aaaatcggccttaaaaagaattcactttttggcaccgatgtaatccaggaactctgcccc
atccccgaattctgtgaaaagatcagcgcaggaaaacgcgcccaggtaacccgtgacttc
atgatcatagcccgccttgaaagcctcatcgcaggcttcccggtttctgacgcccttgaa
cgcgccagggcttttgtcgcggccggggctgacggcatcatgatacacagtaaagaaaaa
tcaggcagcgatatacgcgagttctgcctgaagttccgggccgaatacgaaaaggtaccg
ctggttcttgttcctacttcttataatcagtttttagaaaaggaactttgccaatgggga
gcgtcaattattatttatgctaaccacatgctcagggcttcttatccggcaatgatgaat
gcggcgcggactatactggagaacgagcgggcgcttgaagcagacaaactctgtatgccg
ataaaggaaattcttgaattgatacctgggggaaaatga

DBGET integrated database retrieval system