KEGG   Treponema azotonutricium: TREAZ_2287Help
Entry
TREAZ_2287        CDS       T01506                                 

Definition
alpha-galactosidase AgaN
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
taz  Treponema azotonutricium
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:taz00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:taz00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:taz00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(57698..59932)
Genome map
AA seq 744 aa AA seqDB search
MPITVKNSQFRLDSRSTSYIFSLYLDKYPCHHYWGKTLPKDADLSYLAANRVAYRPSFTT
PIPNTATFLAELQLEFSVLGNGDHRTPVFHAAYADGSTVSDFVYESHRIIKGKPRLRGLP
ATYAEKDSEAETLELILKDTLTGLRVILAYTVFEEYDAIARSIRYENTGQDDIEILSPGS
MGMDFSGQDFRILHLHGDWMRERQIEYIPVAHGIFNADSKRGHSSHMQNPFVALLRGKNA
AEQPDDYATENSGEVYGFSLVYSGNFSAVVEGSPQGGTRVVMGINPFNFSWNLKKGESFQ
TPEVVIVYSDKGLGGMSLRYHKLYRERLARGKHRDAPRPMVINNWEATGMEFTEQKIIDI
AKAGSGLGIEMFVLDDGWFGKRDKDDSSLGDWFTYKEKLPGGLGNLIKTVNGFGMKFGLW
FEPEMVSPDSDLYRAHPDWCLHAEGRHRTTGRDQLVLNLSKAEARDYLFDSITAILKSGN
IEYVKWDCNRNITETSSRDQQHRHMLGVYDLMERLVSTFPDILFESCSGGGGRFDPGILY
YMPQNWTSDNTDPIDRLRIQYGTSLVYPPSAMTAHVGKIKVGETGMNRFMHTCALAAMGF
NFGFELDLSKLSEDERTQAIGYVKTYQSIREVVQYGDFYRLENPFSAATASWMTVSPDKS
RAAAFFFQTRKRRNDEERRIRLKGLEPSRLYKCSEGAVPPNQKEVWGSNNGSQRPAYYGA
ELMEVGIRIPEDGYEYAARMLILE
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgcccattaccgtcaaaaacagccagttccgcctggatagccgcagcacgagctatatc
ttctccctttaccttgataaatacccctgccatcactattggggcaaaacgcttccaaaa
gatgctgacctgagctacctggctgcaaaccgcgtggcatacaggccctcatttaccacg
cctatcccaaataccgcgaccttccttgcggaactccagcttgaattttccgtcctgggg
aatggggatcaccgtaccccggttttccatgccgcctatgccgacggttccacggtgagc
gattttgtgtacgaaagccaccgcatcataaagggcaagccaaggctccggggccttccg
gctacgtatgctgaaaaagacagcgaggccgaaacccttgagctgattttgaaggatacc
ctcacgggcctcagggttattctggcatatacggtttttgaagaatacgatgccattgcc
cgcagcatacgctacgaaaatacaggccaggacgatattgaaatcctctcccccggctcc
atgggcatggatttttccggtcaggatttccgcatactccacctccacggcgactggatg
agggaacggcagattgaatatatccccgtcgctcatgggatcttcaacgccgacagcaag
cggggccattcaagccacatgcagaacccctttgtcgccctgctgcgcggaaagaacgct
gcggaacagcccgatgactatgcaacagaaaacagcggggaagtctacggcttctccctg
gtttactcggggaatttttccgccgttgtcgagggcagcccccagggaggaaccagggta
gtgatgggcatcaacccctttaatttcagctggaatttaaagaagggcgaaagcttccag
acccccgaggtcgtaatagtttattcggacaagggccttggcggcatgagcctccgctac
cacaaactctaccgcgagcgccttgcccggggaaagcaccgcgacgccccaagacccatg
gtgatcaacaactgggaagccacaggcatggaattcaccgagcagaagatcatcgacata
gcaaaagccggaagcggacttggcatagagatgtttgtccttgacgacggctggttcggc
aaaagggacaaggatgattcttccctgggtgactggttcacctacaaggaaaaacttccc
ggtggcctcgggaatcttataaaaacagtcaacggtttcggcatgaaattcggcctctgg
ttcgagccggaaatggtttcccctgacagcgacctctaccgcgctcaccccgactggtgc
ctccacgccgaaggccgccaccgcaccacaggccgggatcagctggtgctgaatctgtct
aaggccgaagcgcgcgattatctctttgacagcattactgcgatcctcaaatcgggaaac
atcgaatatgtaaaatgggattgcaaccgcaatatcaccgagacttcttcacgggatcag
cagcaccgccacatgctgggggtctacgaccttatggaacgccttgtttccacattcccg
gacatactcttcgaaagctgttcaggcggaggcggccgtttcgatcccggcatcctctat
tacatgccccaaaactggaccagcgacaataccgaccccatagaccgcctgcgtatccag
tacggcacttcccttgtgtacccaccctctgccatgaccgcccatgtagggaagatcaaa
gtcggcgaaaccggcatgaaccgctttatgcacacctgcgccctggctgccatgggcttt
aacttcggctttgaactcgacctctccaagctctccgaagatgaacgcacccaggctata
ggctacgtaaaaacttaccagagcatacgtgaagtggtgcagtacggcgacttctaccgc
ctcgaaaatccctttagcgctgctactgcttcctggatgaccgtaagcccggacaaatcc
cgggcggcggccttcttcttccagacccggaaacggcgcaacgacgaagaacgccgcata
cgcctcaagggccttgaaccttcgcgcctttacaaatgcagcgaaggcgcggttccccct
aaccaaaaggaagtttggggcagtaacaacggctcgcagcggcctgcctattacggcgcg
gaacttatggaagtagggatacgcatacccgaagatgggtacgaatatgcggcgaggatg
ttgatattggaatag

DBGET integrated database retrieval system