KEGG   Treponema azotonutricium: TREAZ_2287Help
Entry
TREAZ_2287        CDS       T01506                                 

Definition
alpha-galactosidase AgaN
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
taz  Treponema azotonutricium
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:taz00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    TREAZ_2287
  Lipid metabolism
   00561 Glycerolipid metabolism
    TREAZ_2287
   00600 Sphingolipid metabolism
    TREAZ_2287
Enzymes [BR:taz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     TREAZ_2287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(57698..59932)
Genome map
AA seq 744 aa AA seqDB search
MPITVKNSQFRLDSRSTSYIFSLYLDKYPCHHYWGKTLPKDADLSYLAANRVAYRPSFTT
PIPNTATFLAELQLEFSVLGNGDHRTPVFHAAYADGSTVSDFVYESHRIIKGKPRLRGLP
ATYAEKDSEAETLELILKDTLTGLRVILAYTVFEEYDAIARSIRYENTGQDDIEILSPGS
MGMDFSGQDFRILHLHGDWMRERQIEYIPVAHGIFNADSKRGHSSHMQNPFVALLRGKNA
AEQPDDYATENSGEVYGFSLVYSGNFSAVVEGSPQGGTRVVMGINPFNFSWNLKKGESFQ
TPEVVIVYSDKGLGGMSLRYHKLYRERLARGKHRDAPRPMVINNWEATGMEFTEQKIIDI
AKAGSGLGIEMFVLDDGWFGKRDKDDSSLGDWFTYKEKLPGGLGNLIKTVNGFGMKFGLW
FEPEMVSPDSDLYRAHPDWCLHAEGRHRTTGRDQLVLNLSKAEARDYLFDSITAILKSGN
IEYVKWDCNRNITETSSRDQQHRHMLGVYDLMERLVSTFPDILFESCSGGGGRFDPGILY
YMPQNWTSDNTDPIDRLRIQYGTSLVYPPSAMTAHVGKIKVGETGMNRFMHTCALAAMGF
NFGFELDLSKLSEDERTQAIGYVKTYQSIREVVQYGDFYRLENPFSAATASWMTVSPDKS
RAAAFFFQTRKRRNDEERRIRLKGLEPSRLYKCSEGAVPPNQKEVWGSNNGSQRPAYYGA
ELMEVGIRIPEDGYEYAARMLILE
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgcccattaccgtcaaaaacagccagttccgcctggatagccgcagcacgagctatatc
ttctccctttaccttgataaatacccctgccatcactattggggcaaaacgcttccaaaa
gatgctgacctgagctacctggctgcaaaccgcgtggcatacaggccctcatttaccacg
cctatcccaaataccgcgaccttccttgcggaactccagcttgaattttccgtcctgggg
aatggggatcaccgtaccccggttttccatgccgcctatgccgacggttccacggtgagc
gattttgtgtacgaaagccaccgcatcataaagggcaagccaaggctccggggccttccg
gctacgtatgctgaaaaagacagcgaggccgaaacccttgagctgattttgaaggatacc
ctcacgggcctcagggttattctggcatatacggtttttgaagaatacgatgccattgcc
cgcagcatacgctacgaaaatacaggccaggacgatattgaaatcctctcccccggctcc
atgggcatggatttttccggtcaggatttccgcatactccacctccacggcgactggatg
agggaacggcagattgaatatatccccgtcgctcatgggatcttcaacgccgacagcaag
cggggccattcaagccacatgcagaacccctttgtcgccctgctgcgcggaaagaacgct
gcggaacagcccgatgactatgcaacagaaaacagcggggaagtctacggcttctccctg
gtttactcggggaatttttccgccgttgtcgagggcagcccccagggaggaaccagggta
gtgatgggcatcaacccctttaatttcagctggaatttaaagaagggcgaaagcttccag
acccccgaggtcgtaatagtttattcggacaagggccttggcggcatgagcctccgctac
cacaaactctaccgcgagcgccttgcccggggaaagcaccgcgacgccccaagacccatg
gtgatcaacaactgggaagccacaggcatggaattcaccgagcagaagatcatcgacata
gcaaaagccggaagcggacttggcatagagatgtttgtccttgacgacggctggttcggc
aaaagggacaaggatgattcttccctgggtgactggttcacctacaaggaaaaacttccc
ggtggcctcgggaatcttataaaaacagtcaacggtttcggcatgaaattcggcctctgg
ttcgagccggaaatggtttcccctgacagcgacctctaccgcgctcaccccgactggtgc
ctccacgccgaaggccgccaccgcaccacaggccgggatcagctggtgctgaatctgtct
aaggccgaagcgcgcgattatctctttgacagcattactgcgatcctcaaatcgggaaac
atcgaatatgtaaaatgggattgcaaccgcaatatcaccgagacttcttcacgggatcag
cagcaccgccacatgctgggggtctacgaccttatggaacgccttgtttccacattcccg
gacatactcttcgaaagctgttcaggcggaggcggccgtttcgatcccggcatcctctat
tacatgccccaaaactggaccagcgacaataccgaccccatagaccgcctgcgtatccag
tacggcacttcccttgtgtacccaccctctgccatgaccgcccatgtagggaagatcaaa
gtcggcgaaaccggcatgaaccgctttatgcacacctgcgccctggctgccatgggcttt
aacttcggctttgaactcgacctctccaagctctccgaagatgaacgcacccaggctata
ggctacgtaaaaacttaccagagcatacgtgaagtggtgcagtacggcgacttctaccgc
ctcgaaaatccctttagcgctgctactgcttcctggatgaccgtaagcccggacaaatcc
cgggcggcggccttcttcttccagacccggaaacggcgcaacgacgaagaacgccgcata
cgcctcaagggccttgaaccttcgcgcctttacaaatgcagcgaaggcgcggttccccct
aaccaaaaggaagtttggggcagtaacaacggctcgcagcggcctgcctattacggcgcg
gaacttatggaagtagggatacgcatacccgaagatgggtacgaatatgcggcgaggatg
ttgatattggaatag

DBGET integrated database retrieval system