KEGG   Treponema azotonutricium: TREAZ_2379Help
Entry
TREAZ_2379        CDS       T01506                                 

Definition
glycosyl transferase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
taz  Treponema azotonutricium
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:taz00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TREAZ_2379
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    TREAZ_2379
Enzymes [BR:taz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     TREAZ_2379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3820095..3821783
Genome map
AA seq 562 aa AA seqDB search
MKAVKVLISSILAVLLLIVIIPKTAALSFNDGGHPKALARAIAMEMSDEQALAQTFMLGW
VGAEPSPLILNWIKDRNIGGVKIFGWNTGDTRRLAETVGNLQENALDTRFNIPLLVATDQ
EGGLVRHVKGTTSETPGNMAIGASGRPMDAYWSGFYIGKELSILGINMNFAPAVDLYTNR
DSTLIGPRSFGTDPVQAGILGAAFVRGLATQGVIATAKHYPGHGDTDLDSHGVLPRIDAS
FELLWERELIPYRLLAKEKLPAVMTGHLSFPKTQAGDTPASLSSWFIRDILKEKIGYQGL
IITDDLMMNGATNFAGSLSRAAKQALMAGNDIIMLSKTPSLNDQVWTYLLAAMKDEADFR
ARVRDAAQRILETKLEYLRGDKKIAYIPDLKKVDEGLPDPEGAAFFLDLAARSATIVKGR
ETIFPLDDKKAGKVLLAGQYQDFFNAGKKAYPNAVSYWYSSWSSPDLLYYARNADTIIFC
LSDQGGLNVLRSLKGMEKKIVVFSVLSPVYLDEASWADGAVAVYSYAPESFIAGFSAMLG
RIGAAGQLPFPLNEPLKAVTEN
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcagtaaaagttttaatttcatcaattttagcagtattactgctaattgtcatt
attccaaaaacagcggccctctcctttaatgacggcggacaccccaaagctctggcccgt
gccattgccatggaaatgagcgatgaacaggccctggctcaaaccttcatgctcggctgg
gtaggggccgaaccttcgccccttatactgaactggataaaggacaggaacatcgggggg
gttaaaatctttggctggaataccggcgatacccgcaggcttgcggagacagtcggtaat
ctccaggaaaatgccctggataccaggttcaacatccccctcctcgtggcaaccgatcag
gaagggggcctggtacgccatgtaaaaggaaccaccagcgagactccggggaatatggca
ataggagcctcaggacgccccatggatgcctattggtcgggcttttatataggcaaagag
ctttcaattttagggatcaacatgaatttcgcccctgcggtggatctctacaccaacagg
gattctaccctcataggccccaggtcttttggaacagatccggtacaggcagggattttg
ggggcagcctttgtgcggggcctcgcaacccagggggtaatcgccaccgcaaaacactac
cccggccatggcgacaccgaccttgattcccacggcgtcctcccccgcattgacgcaagc
ttcgagctgctctgggaaagggaactcataccctacaggcttctggcaaaagaaaaactg
cccgcagtaatgacaggccacctttcctttcccaagacccaggcaggggataccccggcc
tccctttcttcctggtttatccgcgatatattgaaagaaaaaatcggataccaggggctc
atcatcactgacgatcttatgatgaacggcgcgaccaatttcgccggtagcctttcgcgg
gctgccaagcaggcccttatggcagggaacgatatcatcatgctttccaaaaccccaagc
cttaacgatcaggtatggacatatcttcttgcggcaatgaaggacgaagccgatttccgt
gcacgggtcagggatgccgcccaaagaattctcgaaacaaaacttgaatacctgcggggg
gataaaaagatcgcgtatatccctgacctaaaaaaagtcgatgaaggcctccccgatccc
gaaggggccgcattctttttggatctcgcagcccgcagcgccactattgttaaaggcagg
gaaactattttcccccttgacgataaaaaagccggaaaagtgctgcttgcaggccagtac
caggattttttcaatgcagggaaaaaggcataccccaatgctgtttcttactggtactcg
tcatggtcatcgccggatttgctttactatgcccggaatgcagataccatcatcttctgc
ctttctgaccaggggggcctcaatgtgctccgcagcctcaagggcatggaaaaaaagatc
gtcgtcttttcggttttaagccctgtctatcttgacgaagcctcatgggcggacggggcc
gtggctgtctacagctatgcccctgaatctttcatcgccggtttctcggccatgctggga
aggataggcgcagcagggcagctgcccttccccctgaatgaacccctcaaggctgtgacg
gaaaactaa

DBGET integrated database retrieval system