KEGG   Treponema azotonutricium: TREAZ_2460Help
Entry
TREAZ_2460        CDS       T01506                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
taz  Treponema azotonutricium
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:taz00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3733124..3735151
Genome map
AA seq 675 aa AA seqDB search
MAEKQDTNRRLIGTVIPVGALRGEKSIGVGEFPDLVEFGSLCARMGIGLIQLLPVNDTGY
QSSPYSALTAFALHPIYLRLGDLPEATSFAAKIKALGEKYNNETRYPYEAILRDKMALLR
EVYAASEKDIAAKAKTGSPLSNWIEANSWVKAYAVFRRLKEANGEKSWKEWKTHQKISAP
EIEALWKDAKLKGEHLFWAWIQEGLDKQFRLAAAALSKLGIILEGDLPILMNEDSCDVWA
HPEIFYQNLSAGAPPDMYSPDGQNWGFPTYDWQAQAKDGYTWWKKRLQAAEKYYQAYRID
HVLGFFRIWASSRDDNSAALGRYVPYKPITAKELSDLGFDESRIRWISQPHIPTGEVWNA
LKAGWGQEFRDADIAAAAEHAFSAALDRIGSEELWLFKKDIKGEKDIWALDIHQAAKAYL
AKAWGNRLFLEYEKGKFFPVWFMRQNRAYPTLNGDEKGRLEAFLEKKRVESEKVWEAEGQ
KLLSTLTESSSMLPCAEDLGAVPDCVPRTLAKLKILGLRVVRWHRQWDREGQPYVPFEDY
PELSVCTPAVHDSSTLREWWDKEADQNQFAGFIGFPSLPKVYNPGTAKIMLHKIAASASR
FRVFQIQDLLHLSNKWYAQDAGSERINVPGTTNEFNWTYRLPASIKAISMDEDLIKAVSE
LADAKPVVKKGARKA
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaaacaagacacaaaccgccgcttaattgggactgttatccccgtgggcgcc
ctgagaggcgagaagagcataggggtaggagaattcccggatcttgttgaattcggcagc
ctctgcgcccgcatgggcatagggcttatccagctccttccggtaaacgacacaggctac
cagagctcgccctatagcgccctgacagcttttgccctgcatcccatctatttaaggctg
ggggatcttcccgaggcgacaagctttgcagccaagatcaaagccctgggcgaaaagtac
aacaatgaaacccgctacccctatgaggcaatactgagggacaagatggccctgctccgc
gaagtctacgctgccagcgagaaggatatagccgcaaaggcaaagacaggctctcccttg
tcaaactggatcgaggctaattcctgggtaaaggcgtatgccgtgttcaggcggcttaag
gaagccaatggcgaaaaaagctggaaagaatggaagacccatcagaagattagcgccccg
gaaatcgaggccctctggaaagatgccaagctaaagggcgagcatcttttttgggcatgg
atccaggaagggttggacaagcagttccgccttgcggcggcggccctttcgaagctcggc
atcatacttgaaggggatcttcctatattgatgaacgaagattcctgcgatgtgtgggct
catcctgaaatattttaccaaaacctttcggctggtgcccctccggacatgtacagcccc
gacggccagaactggggcttcccaacgtatgactggcaggcccaggcaaaggatggctac
acctggtggaagaagcgcctccaagcggctgaaaaatactatcaggcctaccgcatcgat
catgttctgggctttttcaggatttgggcgtcttcgagggacgacaactccgctgcattg
ggccgctatgtcccttataagcccatcaccgcaaaagagctttcggatctcggttttgac
gaaagccgcatacgctggatctcccagccccatatccccacaggggaagtgtggaatgcc
cttaaggcaggctggggccaggaattccgggacgccgacatagccgctgcagcagagcat
gccttttcggcagccctggatcgcataggcagcgaggaactctggctcttcaaaaaagac
ataaaaggcgaaaaggatatttgggccctggacatacatcaggctgccaaagcctacctt
gccaaagcctggggcaacaggctctttttggaatacgaaaaaggcaaattcttccccgtc
tggttcatgcgccaaaaccgcgcgtaccctaccctcaatggggacgaaaagggcaggctc
gaagccttcctcgaaaagaaacgggtagagtctgaaaaggtatgggaagcagaaggccaa
aagctcctttcaaccttgaccgagtcatcgtccatgctgccctgcgccgaggatctcggg
gctgtccccgactgcgtcccccggacgcttgccaagctcaagatacttgggcttagggtg
gtccgctggcaccgtcaatgggacagggagggccagccttatgtccccttcgaggattac
ccggagctgagcgtctgcacccctgcggtgcatgacagttccaccctgcgggaatggtgg
gacaaggaagccgaccagaaccagtttgcggggttcatcggctttccatccctgcccaag
gtatacaaccctggcacggccaagatcatgctccacaaaatagcagcttcagcctcgcgc
ttcagggttttccagatccaggatctgctccacctttccaacaagtggtatgcccaggat
gccggctcagaacgcataaacgtgcctggcaccaccaacgagttcaactggacctatagg
ctccccgcttccatcaaggcgatctccatggacgaggatctgattaaggccgtctccgag
ctggcggatgcaaaacctgtggtgaaaaaaggcgccaggaaggcctaa

DBGET integrated database retrieval system