KEGG   Treponema azotonutricium: TREAZ_2507Help
Entry
TREAZ_2507        CDS       T01506                                 

Definition
(GenBank) acyl-coenzyme A synthetase ACSM3
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
taz  Treponema azotonutricium
Pathway
taz00010  Glycolysis / Gluconeogenesis
taz00620  Pyruvate metabolism
taz00640  Propanoate metabolism
taz00680  Methane metabolism
taz01100  Metabolic pathways
taz01110  Biosynthesis of secondary metabolites
taz01120  Microbial metabolism in diverse environments
taz01130  Biosynthesis of antibiotics
taz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:taz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TREAZ_2507
   00620 Pyruvate metabolism
    TREAZ_2507
   00640 Propanoate metabolism
    TREAZ_2507
  Energy metabolism
   00680 Methane metabolism
    TREAZ_2507
Enzymes [BR:taz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TREAZ_2507
Lipid biosynthesis proteins [BR:taz01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TREAZ_2507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEF82945
UniProt: F5YF58
Position
3706536..3708230
Genome map
AA seq 564 aa AA seqDB search
MNEIQSRYCPHVDFESYDDFYANYSCKVPENFNFAYDVVDEWARLQPKKLALVWTNDEGD
MKSFTFTDIKRQSDKAANALLNLGIKKGDVVMLILKQRPEVWILMAALEKIGAVCIPGTY
QLTQKDIIYRCNIAEVKMLISVDDAELIQNIEASMPDCPNLKHRAIVGNTIPAGFIDMGK
IIAESSENFIRPAGEKDTKLHEPMLIYFSSGTTGMPKMVYHNHCLPLGHIVTAKYWQCVQ
DNKIHLTQTDSGWAKFAWGKIYGQWICGAAIGAYDTEKFTPKGMLDALARIRPATFCAPA
TIFRYLIKEDLSGYDFSYIEHTSVAGEPLSPEVYHQIKEKTGLEIREGFGQSETSIMAAT
FQWLEVRPGSMGKPAPLFGLNLLDENGQACDDGIVGNISITAAGENMYSPKGASIMPGLF
TGYWKDEDVTARCWHDGVYQTGDMAWHDADGYYWFVGRNDDVIKCSGYRIGPFEVESALM
EHPSVLECAVTAAPDPMRGQVVKATIVLAKGFAPSDALKKELQNHVKRVTAPYKYPRIVE
FVSELPKTISGKIQRNVIRKKDGG
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagatacaatcacgctattgtccccatgttgattttgaaagttacgatgatttt
tatgccaattacagctgcaaagtccctgaaaatttcaattttgcctatgatgtagtggac
gaatgggcacggcttcagccaaaaaaactcgccctggtctggacaaacgatgaaggggat
atgaagtccttcaccttcaccgacataaagcgccaaagcgataaagccgccaacgccctc
ctcaatctgggaatcaaaaaaggggacgtagtaatgctgatattaaaacagcgtcccgaa
gtatggatacttatggctgccctcgaaaagataggcgcagtctgcattcccggcacctac
cagctaacccaaaaagatataatctaccgctgcaacattgcggaggtaaaaatgctcatc
agcgtggacgatgccgaactcattcaaaatattgaagcctccatgcccgactgcccgaac
ctcaagcacagggccattgtaggcaacaccattccggcgggttttatcgacatgggcaaa
atcattgccgaaagcagcgaaaatttcattcgtcctgccggagaaaaagataccaaactc
catgaacccatgctgatctatttttcttccggcaccaccggtatgcccaaaatggtgtat
cacaatcactgcctccccctgggccacattgttactgcgaaatactggcagtgcgtgcag
gacaataaaatccaccttacccaaaccgattcaggctgggccaaattcgcctggggcaaa
atctacggccagtggatctgcggggcagccataggcgcctacgacacggaaaaattcacc
ccaaaaggaatgctcgacgccctggcccggataaggcccgccaccttctgcgcccctgcc
accatcttccgctatctcataaaggaagatctttcaggctacgacttctcctacatcgaa
cacacatcagttgccggcgaacccttgagccccgaggtctatcatcagataaaagaaaag
acgggcctcgaaattcgtgaaggcttcggccaatccgaaacttccatcatggctgccacc
ttccaatggctcgaagtgaggcccggctccatgggcaagcccgcccccctctttggcctc
aacctcctggacgaaaacggccaggcctgcgacgacggcatagtaggcaacatctccatc
actgcggctggcgaaaacatgtactcccccaagggcgcctccatcatgcccggcctcttc
accggctactggaaggatgaagatgtcaccgcaagatgctggcacgacggcgtgtaccaa
accggcgacatggcctggcacgacgccgatggctactactggttcgtgggccgcaacgac
gatgtcatcaaatgctcaggttaccgcatcggccccttcgaagtcgaaagcgccctcatg
gagcacccgtcagtcctcgaatgcgccgtcaccgccgccccggaccccatgcgcggccag
gtcgtcaaagccaccatagtcctcgccaaaggcttcgccccttcggatgccctcaaaaaa
gagctccaaaaccacgtcaaacgcgtcaccgccccctacaaatacccccgcatcgtggaa
ttcgtcagcgaactccccaaaaccatcagcggcaagatccagcgcaacgtgatacggaag
aaagacgggggttga

DBGET integrated database retrieval system