KEGG   Treponema azotonutricium: TREAZ_2507Help
Entry
TREAZ_2507        CDS       T01506                                 

Definition
acyl-coenzyme A synthetase ACSM3 (EC:6.2.1.2)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
taz  Treponema azotonutricium
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:taz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TREAZ_2507
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TREAZ_2507
   00620 Pyruvate metabolism
    TREAZ_2507
   00640 Propanoate metabolism
    TREAZ_2507
  Energy metabolism
   00680 Methane metabolism
    TREAZ_2507
Enzymes [BR:taz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TREAZ_2507
Lipid biosynthesis proteins [BR:taz01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TREAZ_2507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3706536..3708230
Genome map
AA seq 564 aa AA seqDB search
MNEIQSRYCPHVDFESYDDFYANYSCKVPENFNFAYDVVDEWARLQPKKLALVWTNDEGD
MKSFTFTDIKRQSDKAANALLNLGIKKGDVVMLILKQRPEVWILMAALEKIGAVCIPGTY
QLTQKDIIYRCNIAEVKMLISVDDAELIQNIEASMPDCPNLKHRAIVGNTIPAGFIDMGK
IIAESSENFIRPAGEKDTKLHEPMLIYFSSGTTGMPKMVYHNHCLPLGHIVTAKYWQCVQ
DNKIHLTQTDSGWAKFAWGKIYGQWICGAAIGAYDTEKFTPKGMLDALARIRPATFCAPA
TIFRYLIKEDLSGYDFSYIEHTSVAGEPLSPEVYHQIKEKTGLEIREGFGQSETSIMAAT
FQWLEVRPGSMGKPAPLFGLNLLDENGQACDDGIVGNISITAAGENMYSPKGASIMPGLF
TGYWKDEDVTARCWHDGVYQTGDMAWHDADGYYWFVGRNDDVIKCSGYRIGPFEVESALM
EHPSVLECAVTAAPDPMRGQVVKATIVLAKGFAPSDALKKELQNHVKRVTAPYKYPRIVE
FVSELPKTISGKIQRNVIRKKDGG
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagatacaatcacgctattgtccccatgttgattttgaaagttacgatgatttt
tatgccaattacagctgcaaagtccctgaaaatttcaattttgcctatgatgtagtggac
gaatgggcacggcttcagccaaaaaaactcgccctggtctggacaaacgatgaaggggat
atgaagtccttcaccttcaccgacataaagcgccaaagcgataaagccgccaacgccctc
ctcaatctgggaatcaaaaaaggggacgtagtaatgctgatattaaaacagcgtcccgaa
gtatggatacttatggctgccctcgaaaagataggcgcagtctgcattcccggcacctac
cagctaacccaaaaagatataatctaccgctgcaacattgcggaggtaaaaatgctcatc
agcgtggacgatgccgaactcattcaaaatattgaagcctccatgcccgactgcccgaac
ctcaagcacagggccattgtaggcaacaccattccggcgggttttatcgacatgggcaaa
atcattgccgaaagcagcgaaaatttcattcgtcctgccggagaaaaagataccaaactc
catgaacccatgctgatctatttttcttccggcaccaccggtatgcccaaaatggtgtat
cacaatcactgcctccccctgggccacattgttactgcgaaatactggcagtgcgtgcag
gacaataaaatccaccttacccaaaccgattcaggctgggccaaattcgcctggggcaaa
atctacggccagtggatctgcggggcagccataggcgcctacgacacggaaaaattcacc
ccaaaaggaatgctcgacgccctggcccggataaggcccgccaccttctgcgcccctgcc
accatcttccgctatctcataaaggaagatctttcaggctacgacttctcctacatcgaa
cacacatcagttgccggcgaacccttgagccccgaggtctatcatcagataaaagaaaag
acgggcctcgaaattcgtgaaggcttcggccaatccgaaacttccatcatggctgccacc
ttccaatggctcgaagtgaggcccggctccatgggcaagcccgcccccctctttggcctc
aacctcctggacgaaaacggccaggcctgcgacgacggcatagtaggcaacatctccatc
actgcggctggcgaaaacatgtactcccccaagggcgcctccatcatgcccggcctcttc
accggctactggaaggatgaagatgtcaccgcaagatgctggcacgacggcgtgtaccaa
accggcgacatggcctggcacgacgccgatggctactactggttcgtgggccgcaacgac
gatgtcatcaaatgctcaggttaccgcatcggccccttcgaagtcgaaagcgccctcatg
gagcacccgtcagtcctcgaatgcgccgtcaccgccgccccggaccccatgcgcggccag
gtcgtcaaagccaccatagtcctcgccaaaggcttcgccccttcggatgccctcaaaaaa
gagctccaaaaccacgtcaaacgcgtcaccgccccctacaaatacccccgcatcgtggaa
ttcgtcagcgaactccccaaaaccatcagcggcaagatccagcgcaacgtgatacggaag
aaagacgggggttga

DBGET integrated database retrieval system