KEGG   Treponema azotonutricium: TREAZ_2534Help
Entry
TREAZ_2534        CDS       T01506                                 

Gene name
thrC_2
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
taz  Treponema azotonutricium
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:taz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TREAZ_2534 (thrC_2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TREAZ_2534 (thrC_2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TREAZ_2534 (thrC_2)
Enzymes [BR:taz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TREAZ_2534 (thrC_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3675915..3677219
Genome map
AA seq 434 aa AA seqDB search
MQFRSTKALGPQVSFKDAVLRCLPVDGGLYVPSTVPDMRQFFLYMDEKTTYPELIAAVAP
SLLQGELNPFSASRVAESAFDFEPDLKQLDDNFSILSLYNGPTGVFKDFGVAFLAAVLEE
LTKNSGNVMVISAARGITGISIAKAFQGRQGLTAVLLYPAGTIRGLDPATFVPNGGNIIP
IQVRGTYDDCQALIAELINDRPFAERYQVTSANTINPGRLLPQAFYYLYAFIKAKKYLSG
DLVFSVPSGNFGNLISGLYAWKFGMPVNGFIAAMNANNIFGDFMRGGKYTPHPLVTTNSP
ALDISQPSNYERLASFYEESPAVMRNMVFPAAIDDETTIKTIKEAWTQYGILLNPHSAVA
FAAAKGFAKDRDYGTHAIVLATGHPAREAELVEKATGQTAGLPEKLHILNKRSEPIALID
PELDSLESAIASCL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttcgatctaccaaggctttagggccgcaggtttcattcaaagacgccgttctc
cgctgtctcccggtcgacggagggctctatgtgccttccacagtgcccgatatgaggcag
tttttcctttatatggacgaaaaaaccacgtaccccgagctgatagccgccgtagcgcca
agccttctccagggcgaactcaatcccttctccgcttcccgggtggctgaaagcgctttc
gacttcgagcccgaccttaaacagctggacgacaacttttccatcctaagcctctacaac
ggccccaccggggttttcaaagacttcggcgtggccttcctcgcggcagtgctggaagaa
ctcaccaaaaacagcggcaatgtcatggtcatttctgcagccaggggcatcacggggatc
agcatagccaaagccttccagggccgccaggggcttaccgcagtgctcctctaccccgcc
ggaaccatcaggggacttgaccccgccacctttgtgcccaatggcggcaatatcatcccc
atccaggtcagggggacctacgacgattgccaggccctcattgctgaattgataaacgac
aggccctttgcggaacgctaccaggtaaccagcgccaacaccatcaatcccgggcgcctc
ctgccccaggcattttattatctctatgcttttatcaaggcaaaaaaatacctttccggc
gacctggttttctcggtgccttcgggaaatttcggcaacctcatttcggggctttatgcc
tggaaattcggcatgcctgtaaacggttttatcgctgccatgaacgcaaataatattttt
ggagattttatgcggggcggcaagtatacaccccatccattggtgacaaccaattcccct
gcccttgatatttcccagccttcaaactacgaaaggctggcatccttctatgaagaatcc
cctgcggtaatgcggaacatggtattccccgcagccattgatgatgaaaccaccattaag
acaataaaagaagcatggacccaatacggcatactcctgaacccccacagcgccgtagcc
tttgccgccgccaaaggctttgccaaagaccgggattacggtacccatgccatcgtactc
gccacaggccaccctgcacgggaagcggaactcgtggaaaaagccacaggccagactgcg
ggactcccggaaaaactccacatactgaacaagcgttcggaacccatagccctcatcgat
cccgaacttgactcccttgaaagcgctattgccagctgcctctaa

DBGET integrated database retrieval system