KEGG   Treponema azotonutricium: TREAZ_2534Help
Entry
TREAZ_2534        CDS       T01506                                 

Gene name
thrC_2
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
taz  Treponema azotonutricium
Pathway
taz00260  Glycine, serine and threonine metabolism
taz00750  Vitamin B6 metabolism
taz01100  Metabolic pathways
taz01110  Biosynthesis of secondary metabolites
taz01120  Microbial metabolism in diverse environments
taz01230  Biosynthesis of amino acids
Module
taz_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:taz00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TREAZ_2534 (thrC_2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TREAZ_2534 (thrC_2)
Enzymes [BR:taz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TREAZ_2534 (thrC_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AEF82008
UniProt: F5YF34
Position
3675915..3677219
Genome map
AA seq 434 aa AA seqDB search
MQFRSTKALGPQVSFKDAVLRCLPVDGGLYVPSTVPDMRQFFLYMDEKTTYPELIAAVAP
SLLQGELNPFSASRVAESAFDFEPDLKQLDDNFSILSLYNGPTGVFKDFGVAFLAAVLEE
LTKNSGNVMVISAARGITGISIAKAFQGRQGLTAVLLYPAGTIRGLDPATFVPNGGNIIP
IQVRGTYDDCQALIAELINDRPFAERYQVTSANTINPGRLLPQAFYYLYAFIKAKKYLSG
DLVFSVPSGNFGNLISGLYAWKFGMPVNGFIAAMNANNIFGDFMRGGKYTPHPLVTTNSP
ALDISQPSNYERLASFYEESPAVMRNMVFPAAIDDETTIKTIKEAWTQYGILLNPHSAVA
FAAAKGFAKDRDYGTHAIVLATGHPAREAELVEKATGQTAGLPEKLHILNKRSEPIALID
PELDSLESAIASCL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttcgatctaccaaggctttagggccgcaggtttcattcaaagacgccgttctc
cgctgtctcccggtcgacggagggctctatgtgccttccacagtgcccgatatgaggcag
tttttcctttatatggacgaaaaaaccacgtaccccgagctgatagccgccgtagcgcca
agccttctccagggcgaactcaatcccttctccgcttcccgggtggctgaaagcgctttc
gacttcgagcccgaccttaaacagctggacgacaacttttccatcctaagcctctacaac
ggccccaccggggttttcaaagacttcggcgtggccttcctcgcggcagtgctggaagaa
ctcaccaaaaacagcggcaatgtcatggtcatttctgcagccaggggcatcacggggatc
agcatagccaaagccttccagggccgccaggggcttaccgcagtgctcctctaccccgcc
ggaaccatcaggggacttgaccccgccacctttgtgcccaatggcggcaatatcatcccc
atccaggtcagggggacctacgacgattgccaggccctcattgctgaattgataaacgac
aggccctttgcggaacgctaccaggtaaccagcgccaacaccatcaatcccgggcgcctc
ctgccccaggcattttattatctctatgcttttatcaaggcaaaaaaatacctttccggc
gacctggttttctcggtgccttcgggaaatttcggcaacctcatttcggggctttatgcc
tggaaattcggcatgcctgtaaacggttttatcgctgccatgaacgcaaataatattttt
ggagattttatgcggggcggcaagtatacaccccatccattggtgacaaccaattcccct
gcccttgatatttcccagccttcaaactacgaaaggctggcatccttctatgaagaatcc
cctgcggtaatgcggaacatggtattccccgcagccattgatgatgaaaccaccattaag
acaataaaagaagcatggacccaatacggcatactcctgaacccccacagcgccgtagcc
tttgccgccgccaaaggctttgccaaagaccgggattacggtacccatgccatcgtactc
gccacaggccaccctgcacgggaagcggaactcgtggaaaaagccacaggccagactgcg
ggactcccggaaaaactccacatactgaacaagcgttcggaacccatagccctcatcgat
cccgaacttgactcccttgaaagcgctattgccagctgcctctaa

DBGET integrated database retrieval system