KEGG   Treponema azotonutricium: TREAZ_2723Help
Entry
TREAZ_2723        CDS       T01506                                 

Gene name
thrC_1
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
taz  Treponema azotonutricium
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:taz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TREAZ_2723 (thrC_1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TREAZ_2723 (thrC_1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TREAZ_2723 (thrC_1)
Enzymes [BR:taz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TREAZ_2723 (thrC_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3470391..3471716)
Genome map
AA seq 441 aa AA seqDB search
MHYYSTRDKNTAVSFADAALGGLAPDGGLYVPETIPLYSGAVKSSLGTMDYADIAFETIK
PWVEADIPNAVLEDMVHSAYPFDAPLVSVGDRFVLELFHGPTAAFKDFGARFMARSFSYL
RRGEGKPLKILVATSGDTGGAVADGFYGVEGISVTVLYPKGRVSPLQERQIAGLGGNISA
IAVEGSFDDCQSLVKQAFGDEVLKKRLVLSSANSINVSRLIPQAAYYSAGAGRASGKQKT
GLIVCVPSGNFGNLTAGLYAFKMGAPINLFIAATNINKTVPDFLENGKYEARKSQATLSN
AMDVGAPSNFERMAAHFSWEEMRRLILGVYTDDEDTRKTIGAVYRDCAYFLDPHTAVGWH
GVDKLRDSGALPCGPWGKGSENPLAVLSTAHPAKFAETVETLTGPVPLPDSLKKAMDRKA
EARTITAEFEALKELLLGNTL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgcactactatagtacccgcgataaaaataccgctgtgagttttgcagatgcagccctt
ggcggccttgcccccgatggcggcctctatgttcccgagactatccccctctattccggg
gcggttaaatcctcccttggaaccatggattatgccgacatagcctttgaaaccatcaag
ccatgggtcgaggcggatattcccaatgcggttctggaagatatggttcattcggcttat
ccctttgatgcgcctttagtgagcgtaggcgacagatttgtgctggaacttttccacggc
cccaccgcagctttcaaggattttggcgcccgttttatggcacggtctttttcgtacctc
cgccggggcgaggggaagccgcttaaaattctcgtggctacttcgggcgatacgggaggg
gccgtagccgatggattctatggtgtcgaaggcatcagcgttactgtgctttaccccaaa
ggcagggtgtcgcccctgcaggaacgccagattgcgggccttggcggcaatatatccgcc
atcgcggtggaaggcagttttgacgattgccagagccttgtaaagcaggcctttggcgat
gaggttcttaaaaaacgtttggttctctcgtcggccaattccatcaatgtatcccggctc
attccccaggctgcctattattctgcgggcgcaggcagggcttcgggcaaacagaaaacc
ggcctcatcgtttgcgttccttcgggaaatttcggcaatctgactgccggcctttatgcc
tttaaaatgggcgctcctattaatttatttattgcggccaccaatatcaacaagacagtt
cccgacttcctcgaaaacggaaaatacgaagcccgcaaatcacaggccaccctttccaac
gccatggacgtgggcgcacccagcaactttgagcgcatggctgcgcacttttcctgggag
gaaatgcgccggcttatccttggcgtttacaccgatgatgaggatacacgcaaaaccatt
ggggctgtttacagggattgcgcttatttcctcgatcctcacactgccgttggctggcat
ggggtggacaagcttcgtgattcaggagccctcccctgcggcccctggggtaaaggatcg
gagaatcccctggctgttctttcaactgcccatcctgccaagttcgcggaaaccgtggag
accctcaccggccctgtccctctgcccgattcgcttaagaaggctatggacaggaaggca
gaggcccgcactattactgcggaatttgaagcgctaaaagaattactattaggaaataca
ttatga

DBGET integrated database retrieval system