KEGG   Treponema azotonutricium: TREAZ_2753Help
Entry
TREAZ_2753        CDS       T01506                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
taz  Treponema azotonutricium
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Butirosin and neomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:taz01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:taz00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:taz00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:taz00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:taz00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:taz00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis [PATH:taz00524]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3439496..3440413)
Genome map
AA seq 305 aa AA seqDB search
MNENKVYIGIDIGGTKTAISSGNSVGRILGKKAFPTDRDLKQALKNIFTEVETFISQNGK
ENIAAMGISCGGPLDSDKGIIQSPPNLPGWDDVHIIEMLKDEFSLPVFIENDANACALAE
WYYGAGRGCKNMIFLTFGTGLGAGLILDGRLYRGANGLAGEVGHIRMTEGGPLGYGKKGS
LEGWCSGGGISEAYFDRYGERISGGEVCKRAEKGDAMALAIIEESALMLGKGLALFIDII
NPERIVIGSIFARSESLFRSRVEKAIKEEALPLAAGVCKVLPAELGESLGDTAAICAAVN
GLSAK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagaataaagtatatattggcattgacataggcggcactaaaaccgcgatatcc
tcaggcaattctgtggggcggatattaggcaagaaggcttttcccaccgacagggatttg
aaacaggccctaaaaaatatatttactgaagtagagacttttatatcgcaaaatggaaaa
gagaatattgccgctatgggtatttcctgcggcggccctttggatagcgacaaggggatt
attcagtcccccccaaacctccccggctgggatgatgtgcatatcatagaaatgctgaaa
gatgaattcagccttccagtattcatagaaaatgatgccaatgcctgcgctcttgcggaa
tggtactatggcgcaggcaggggttgcaaaaacatgatcttcctcacctttggcaccggc
cttggcgcgggcctcatcctggacggaaggctctaccggggggcaaatggccttgcaggg
gaagtgggccacatcaggatgactgaaggcggacccttgggctacggcaaaaaaggttcc
ctggaaggctggtgttcggggggcgggatttcggaagcttattttgaccgttacggtgaa
agaatttcaggcggcgaagtatgcaaaagagccgaaaagggcgatgccatggcccttgca
ataatcgaagagagcgccctcatgctgggcaaggggcttgccctttttattgatattata
aaccctgaaagaatcgttataggcagtatctttgcgcgcagcgaatcccttttccgcagc
agggtggaaaaagcgattaaagaagaagcccttccccttgccgcaggggtctgcaaagtg
ctgcctgcggaattgggggaatcattgggggataccgccgcaatttgcgcagcggtaaac
ggcctgtccgcaaagtga

DBGET integrated database retrieval system