KEGG   Treponema azotonutricium: TREAZ_2774Help
Entry
TREAZ_2774        CDS       T01506                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
taz  Treponema azotonutricium
Pathway
taz00330  Arginine and proline metabolism
taz00332  Carbapenem biosynthesis
taz01100  Metabolic pathways
taz01130  Biosynthesis of antibiotics
taz01230  Biosynthesis of amino acids
Module
taz_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:taz00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    TREAZ_2774 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    TREAZ_2774 (proB)
Enzymes [BR:taz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     TREAZ_2774 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase GST_C_4 Peripla_BP_4 AChE_tetra
Motif
Other DBs
NCBI-ProteinID: AEF80957
UniProt: F5YD39
Position
3417904..3418695
Genome map
AA seq 263 aa AA seqDB search
MIPKLIADARKIVFKFGSNTLADKEGKINTFFLDELAEQTAALMKKGKQIVIVSSGAQVA
GTSTMGKWARKRDIHYRQALCAVGQVELMGAWRRAFEKYSIHIAQILLTRDDFGDSNRTL
NMRNTLFTLVDEGIIPIINENDTVSVEEIKIGENDTLAAQSAILWSADLLILFSDIDGLY
NKNPKEFPDAELVPIVNDIAEIRKSIAIGGTNNFGTGGIATKLLAAEQALPYGIPTIIAH
GGKPRMLEALAAGKQQGTAFLVS
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgataccaaaactaatcgcagacgcgcggaaaatagtctttaagttcggttccaatacc
ctggccgacaaggaaggtaaaatcaacactttcttccttgatgaattggcggaacaaaca
gcggcactgatgaaaaagggcaaacagatcgtcatcgtatcttccggggcacaagtggcg
ggcacttcgaccatggggaagtgggcgcggaaacgggacatccactacaggcaggccctc
tgcgccgtgggccaggttgaactcatgggcgcatggaggcgggcctttgaaaagtacagc
attcacattgcccagatactcctgacccgggacgacttcggcgattccaaccgcaccctc
aacatgaggaacaccctctttaccctggtggacgagggcatcatccccatcatcaatgag
aacgacacagtctctgtagaagaaatcaaaatcggcgagaacgacaccctggctgcccag
tcggctatactctggagcgcggatctcctcatccttttcagcgacatagatgggctctac
aacaagaaccccaaagaattccccgacgcggaactggtgcctatcgtcaatgacattgcg
gagatacggaagtccatcgccatcgggggaaccaacaatttcggtaccggcggcatcgcc
accaaacttttggcggcggaacaggccctgccctacggcatacccaccatcattgcccac
ggaggcaagccccgtatgctcgaagccctggccgcaggcaaacaacagggaacagccttt
ttggtaagctga

DBGET integrated database retrieval system