KEGG   Treponema azotonutricium: TREAZ_3084Help
Entry
TREAZ_3084        CDS       T01506                                 

Gene name
fucI
Definition
arabinose isomerase (EC:5.3.1.25)
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
taz  Treponema azotonutricium
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:taz00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    TREAZ_3084 (fucI)
Enzymes [BR:taz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     TREAZ_3084 (fucI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3107421..3109235
Genome map
AA seq 604 aa AA seqDB search
MADLSSLKVTAPVNRYRGALPKIGIRPTIDGRRRGVRESLEEPTMNMAKAAAKLISENLR
HPNGQPIECVIADSCIGGVAEAAACQDKFSRENVGVTLTVTPCWCYGSETMDMDPATIKA
VWGFNGTDRPGAVYLAAVLAAHSQKGLPAFGIYGRDVMDMADITKVPQDVQDKILRFAKA
ALAAVWMRGKSYLSIGSVAMGIAGSISNADFFQEYLGMRNEYVDMSELVRRFDEKIYSDA
EYKRALEWVKKNCKEGPDNNPPKEQHSRRRKDEVWKTVVKMAIIVRDLMIGNPDLKRKGL
IEESLGHNAILAGFQGQRQWTDHFPNGDFMEVILNSSFDWNGIRSPYVVATENDGLNGVS
MLFGYLLTGCAQVFADVRTYWSPDAIQRVTGWKPEGLAANGLIHLINSGSAALDGIGKQK
INGKPAWKPFWEITPEEAGACLDSVSWRYGSLGYFRGGGYSSDFLSEGGMPVTMTRLNLV
KGLGPVLQIAEGHTASVPENVHDKLDARTDPTWPTTWFAPRITGEGPFKDVYTVMAKWGA
NHGAVSYGHIGADLITLASILRIPVCMHNVELDKIYRPSYWNSFGMDAESADYRACDALG
PLFK
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggctgatctttccagtctcaaagtgaccgctccggtaaatcgctatcggggggctctg
cccaaaatcgggattcgtcccaccattgacggacgccgccggggggtccgcgaatccctt
gaagagccgaccatgaatatggccaaggccgccgccaagctcatcagcgaaaacctgcgc
cacccgaacggccagcctattgaatgtgtaatcgccgattcctgtataggcggagtggcc
gaagccgctgcctgtcaggacaaattctcccgcgagaacgtgggcgttaccctcacggtt
accccctgctggtgttatggttcagaaaccatggacatggaccccgctaccatcaaggct
gtgtggggcttcaacgggaccgacaggcccggcgcggtttacctcgccgcagttctggcc
gcccattcccagaagggcctccccgccttcggcatctacggccgcgatgttatggatatg
gcggacatcaccaaggtgccccaggatgtgcaggacaagatcctccgctttgccaaggcc
gccctggccgccgtgtggatgaggggcaagagctacctttccatcggttcagtcgccatg
ggtattgccggttccatctccaacgccgacttcttccaggaatacctggggatgaggaac
gaatacgtggatatgtccgaactggtacgccgcttcgatgaaaagatctattccgatgcc
gaatacaagcgggccctggaatgggtcaaaaagaactgcaaggaaggcccggacaacaat
ccgcccaaagaacagcacagccgccgccgcaaggacgaagtctggaagacggtggtcaaa
atggccatcatagtcagggatctcatgatcggcaatcccgacctcaagaggaagggcctg
atcgaagaatccctgggccacaacgccatacttgcaggcttccagggccagcgccaatgg
accgatcacttccccaacggcgactttatggaagtgatactcaattcttcctttgactgg
aacggcatacgttccccctacgtcgtggctaccgaaaacgacggcctcaacggcgtctcc
atgctcttcggctacctcctcacgggctgcgcccaggtctttgccgatgtgcgcacctac
tggagccccgacgccatacagcgggtcaccggctggaagcccgaaggccttgccgccaac
ggccttatccaccttatcaattcaggttctgccgctctggacggcataggcaagcagaaa
atcaacggcaaacccgcctggaagcccttctgggaaatcacccccgaagaagccggcgcc
tgccttgactcggtaagctggcgctacggcagcctcggctacttcagaggcggcggctac
tcctccgacttcctctccgaaggcggaatgcccgtcaccatgacccgcctcaatctggtc
aagggcctcggccccgtcctccagatcgccgaaggccacaccgcctcggtccccgaaaat
gtccacgacaagctcgacgcccgcaccgatcccacctggcccaccacctggtttgccccg
aggatcaccggcgaaggccccttcaaggatgtgtacacggtcatggcaaaatggggcgcc
aaccacggcgcagtctcctacggccacataggcgccgacctcatcaccctggcgagcata
ctccgcatcccggtctgcatgcacaacgtcgagcttgataagatctaccgccccagctac
tggaacagcttcggcatggacgctgaaagcgccgactaccgcgcctgtgacgctctgggt
cccctgtttaagtaa

DBGET integrated database retrieval system