KEGG   Treponema azotonutricium: TREAZ_3205Help
Entry
TREAZ_3205        CDS       T01506                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
taz  Treponema azotonutricium
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:taz00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    TREAZ_3205 (glpK)
Enzymes [BR:taz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     TREAZ_3205 (glpK)
Exosome [BR:taz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TREAZ_3205 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2975857..2977341
Genome map
AA seq 494 aa AA seqDB search
MGKYILALDQGTTSSRAILFDRDQNIAGVEQKEFVQIYPREGWVEHDPMEIYSSQYAVMM
ELLTRKDVSPKDIAAIGITNQRETTIVWDKKTGRPIYNAIVWQCRRTSDIVDALVKDGLG
DHIKNTTGLVADAYFSGTKIKWILDHVEGSRERARKGELLFGTVDTWLVWKFTNGAVHAT
DYTNASRTMLYDIRKLGWDDKLLKALDIPREMLPEVYPSGRVFGTANIQGEEIPIAGIAG
DQQAALFGQCCFEKGEAKNTYGTGCFLLMNTGDIPYESENGLLTTIAASLDTRVQYVLEG
SVFVGGAVIQWLRDEMRFITESADSEYYANKVPDTGGVYLVPAFTGLGAPYWDMYARGCI
MGLTRGTKRYHIIRAAEESIAYQSLDLVRAMEKDTGTQLTELKVDGGASRDAFLMQFQAD
IMGGEIKRPVVRETTALGAACLAGIATGFWKDKDEVRAKWRCDVAFAPKMEKARQEELLE
GWHKAVGRSRGWAN
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaatacattttggctcttgatcagggaaccaccagttcccgggccatactcttt
gaccgggatcagaacatcgccggcgtggagcagaaggaatttgttcagatttatccccgc
gagggctgggtggagcatgatcccatggagatctattcgtcccagtacgcggtgatgatg
gaactccttacgaggaaagatgtttctcccaaggacatagctgccataggcatcaccaac
cagagggaaactaccatcgtctgggataaaaaaacaggcaggcccatttacaatgccatc
gtatggcaatgccgccgtacctccgatattgtagacgccctcgtaaaagacggcctcggg
gatcatatcaaaaataccacgggcctcgtggctgacgcgtatttttcgggaaccaagatc
aaatggatactcgatcatgtggaaggctcccgggagagggcaaggaagggggagctgctc
ttcggcactgtggatacctggcttgtctggaaatttaccaatggcgcggtacacgccacg
gactacaccaacgccagccgtaccatgctctacgacatacgcaagctcggctgggacgac
aaactcctcaaggccctggacatacccagggagatgctgccggaggtttatccttcaggc
agggttttcggcacagcaaatatccagggcgaagaaatccccatagcagggattgctggg
gatcagcaggcggcccttttcggccaatgctgttttgaaaaaggggaagccaagaacact
tacggtacaggatgcttcctcctcatgaacaccggggacataccctacgaaagcgaaaac
gggcttcttaccactattgctgcgagcctggacaccagggttcagtacgtgctcgaagga
tctgtctttgtgggaggggcggtgatccagtggctcagggatgagatgcgcttcatcacc
gagagcgccgattccgaatactatgccaataaagtccccgacacagggggcgtctacctg
gtgccggccttcacgggcttgggcgcgccgtactgggacatgtacgcccggggctgcatc
atgggcctcaccaggggaaccaaacgctaccacatcatcagggcagccgaagaatccatt
gcctaccagagcctcgatctggtacgggccatggagaaagacacaggaacgcaattaacc
gaattgaaagttgacggcggcgccagcagggacgccttcctcatgcagttccaggcggat
atcatgggcggagaaatcaaacgccctgttgtccgggaaaccaccgccctgggcgcagcc
tgccttgcgggcattgcgacaggcttttggaaggacaaggatgaagtgcgcgccaaatgg
cgctgcgatgttgcctttgccccaaaaatggaaaaagcccggcaagaggaactgctcgaa
ggctggcacaaagccgtaggccgcagcaggggctgggcgaactag

DBGET integrated database retrieval system