KEGG   Treponema azotonutricium: TREAZ_3384Help
Entry
TREAZ_3384        CDS       T01506                                 

Definition
(GenBank) bifunctional PGK/TIM
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
taz  Treponema azotonutricium
Pathway
taz00010  Glycolysis / Gluconeogenesis
taz00051  Fructose and mannose metabolism
taz00562  Inositol phosphate metabolism
taz01100  Metabolic pathways
taz01110  Biosynthesis of secondary metabolites
taz01120  Microbial metabolism in diverse environments
taz01130  Biosynthesis of antibiotics
taz01200  Carbon metabolism
taz01230  Biosynthesis of amino acids
Module
taz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
taz_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:taz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TREAZ_3384
   00051 Fructose and mannose metabolism
    TREAZ_3384
   00562 Inositol phosphate metabolism
    TREAZ_3384
Enzymes [BR:taz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     TREAZ_3384
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TREAZ_3384
Exosome [BR:taz04147]
 Exosomal proteins
  Proteins found in most exosomes
   TREAZ_3384
  Exosomal proteins of colorectal cancer cells
   TREAZ_3384
  Exosomal proteins of bladder cancer cells
   TREAZ_3384
  Exosomal proteins of melanoma cells
   TREAZ_3384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGK TIM SidE
Motif
Other DBs
NCBI-ProteinID: AEF80328
UniProt: F5Y8D6
Position
complement(2792816..2794822)
Genome map
AA seq 668 aa AA seqDB search
MIKTVKTVDLKGKRVIMRVDFNVPMKDGVVQDDTRITAAIPTIKYILGQGVKTLTLMSHL
GDPSKDAEKAKGKAEKDGKTFDLDKYIKGKHRMAPVAAYLSKKLKLPVVFAGEDSCYGKK
ALIDSQKPGTIIMLENTRFHKEETSKDDAQRDKLAKALAEYGDIFVNDAFGTAHRDHAST
ASIAKFVPVSVAGFLMEKEVNYLEPIVTNPVKPLVAIIGGAKVSSKIAVLESLLKNASAL
VIGGGMAYTFLKAQGKKIGKSLVEDDQIDTAKKILETAKKVGAEIVLPVDHVGADKFDAA
AEPVAVDNVNLPAKLMGLDVGPKTIAKYKEVLSKAKTIVWNGPVGVFEFDAFAKGTEAVA
KLVAEATARGAITVVGGGDSVAAVNKFGLASKMSHVSTGGGASLELLEGKKLPGIEVTRS
RDYFIAGNWKMHKTRAEAAALAKALVKALKPGKHKYLVAPTFTALETVGAIVKGTNILLG
AQNCAPEEQGAHTGEVSVLQLKDLGVDAIILGHSERRHIYKEDDTLINKKVKLALKHGFE
VILCVGELLEEREKGKAEAVCKRQTEKGLAGVTPEELSKITIAYEPVWAIGTGKTATPDD
AEAIHAYIRSVIAKLYGAQAAKQIVIQYGGSVKAENAAQLMAKEDIDGALVGGAALKEET
FAPIAKFS
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgattaagacagtaaaaaccgtagaccttaaaggcaagcgggttatcatgcgggtggac
ttcaatgtccccatgaaggacggggtcgtacaggacgatacccgcatcacggcggctatt
cccactatcaagtacattctgggccagggcgtcaaaacccttaccctcatgagccatttg
ggggatccttccaaggacgccgaaaaagccaagggcaaggccgaaaaagacggcaagacc
tttgacctcgacaagtacatcaagggcaagcaccgcatggcgcctgtggccgcctatttg
tcgaagaagctcaaactgcccgtggtcttcgcaggcgaggatagctgctacggcaagaag
gccctcatcgactcccagaagcccggcaccatcatcatgctcgaaaacacccgcttccat
aaggaagaaacttccaaagatgatgcacagcgggacaagctcgccaaggcccttgccgaa
tacggcgatatttttgtgaacgatgccttcggcactgcccacagggatcacgcttccacc
gcttccattgccaagttcgtaccggtttcagtggcgggcttcctcatggaaaaagaagtg
aactaccttgaacccattgttaccaaccctgtgaaacccctggtggccataatcggcggc
gcaaaggtgtcgtccaaaatcgcggttctggaatccctcctcaagaatgcctcggcactc
gtcataggcggaggcatggcctataccttcctcaaggcccagggcaaaaagatcggcaag
tcccttgtcgaagatgatcagatagacactgccaaaaagatcctcgaaaccgccaagaaa
gtgggcgcagaaatagtgctgcccgtggatcatgtcggggccgataaattcgacgccgca
gcagaacctgtagcggtggataatgtaaacctcccggcgaagctcatgggccttgacgtg
ggtcccaagaccattgccaagtacaaggaagttctttccaaggccaagactatagtgtgg
aacggccctgtaggggtttttgaattcgacgcctttgctaagggaaccgaagcggttgcc
aaacttgtggcggaagccacagcccgcggtgctatcactgttgtaggcggcggtgactcg
gtggcggcggtcaacaaattcggccttgcctccaagatgagccatgtgtccacaggcggc
ggcgcttccctcgaactcctggaaggcaaaaaacttcccggcatcgaagttacccgttcc
cgggattacttcatcgccggaaactggaaaatgcacaagacccgcgccgaagcggcggcc
cttgccaaagccctggtaaaagccctcaagcccgggaagcacaagtacctggtggccccg
acttttaccgccctcgaaacagtgggcgcaattgtcaaaggtaccaacatcttgctgggc
gcccagaactgcgcccccgaagaacaaggcgcccatacgggcgaagtatccgtactccag
cttaaggatctcggcgtcgacgccatcattctgggccacagcgagaggcggcacatttac
aaggaagacgacacccttatcaacaagaaggtaaagctggccctgaagcacggttttgaa
gtcatactctgcgttggcgagcttctcgaagaaagagagaagggaaaggccgaagcggtg
tgcaaacgccagactgaaaagggcctcgccggtgttacccccgaggaactttcaaagatc
accattgcctacgagcctgtatgggccatcggtaccggcaagaccgcaactcctgatgat
gccgaagccattcacgcctacatacgcagcgtgatcgccaagctttacggggcccaggct
gcaaaacagatagtcattcagtatggcggatcggttaaggcagagaacgcggcccagctt
atggccaaggaagacatagacggcgcccttgtgggcggcgctgccctcaaagaagagacc
tttgcgcccatagcgaagttcagctaa

DBGET integrated database retrieval system