KEGG   Treponema azotonutricium: TREAZ_3384Help
Entry
TREAZ_3384        CDS       T01506                                 

Definition
(RefSeq) bifunctional phosphoglycerate kinase/triose-phosphate isomerase (EC:2.7.2.3 5.3.1.1)
  KO
K00927  
phosphoglycerate kinase [EC:2.7.2.3]
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
taz  Treponema azotonutricium
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:taz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TREAZ_3384
   01230 Biosynthesis of amino acids
    TREAZ_3384
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TREAZ_3384
   00051 Fructose and mannose metabolism
    TREAZ_3384
   00562 Inositol phosphate metabolism
    TREAZ_3384
Enzymes [BR:taz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     TREAZ_3384
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TREAZ_3384
Exosome [BR:taz04147]
 Exosomal proteins
  Proteins found in most exosomes
   TREAZ_3384
  Exosomal proteins of colorectal cancer cells
   TREAZ_3384
  Exosomal proteins of bladder cancer cells
   TREAZ_3384
  Exosomal proteins of melanoma cells
   TREAZ_3384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2792816..2794822)
Genome map
AA seq 668 aa AA seqDB search
MIKTVKTVDLKGKRVIMRVDFNVPMKDGVVQDDTRITAAIPTIKYILGQGVKTLTLMSHL
GDPSKDAEKAKGKAEKDGKTFDLDKYIKGKHRMAPVAAYLSKKLKLPVVFAGEDSCYGKK
ALIDSQKPGTIIMLENTRFHKEETSKDDAQRDKLAKALAEYGDIFVNDAFGTAHRDHAST
ASIAKFVPVSVAGFLMEKEVNYLEPIVTNPVKPLVAIIGGAKVSSKIAVLESLLKNASAL
VIGGGMAYTFLKAQGKKIGKSLVEDDQIDTAKKILETAKKVGAEIVLPVDHVGADKFDAA
AEPVAVDNVNLPAKLMGLDVGPKTIAKYKEVLSKAKTIVWNGPVGVFEFDAFAKGTEAVA
KLVAEATARGAITVVGGGDSVAAVNKFGLASKMSHVSTGGGASLELLEGKKLPGIEVTRS
RDYFIAGNWKMHKTRAEAAALAKALVKALKPGKHKYLVAPTFTALETVGAIVKGTNILLG
AQNCAPEEQGAHTGEVSVLQLKDLGVDAIILGHSERRHIYKEDDTLINKKVKLALKHGFE
VILCVGELLEEREKGKAEAVCKRQTEKGLAGVTPEELSKITIAYEPVWAIGTGKTATPDD
AEAIHAYIRSVIAKLYGAQAAKQIVIQYGGSVKAENAAQLMAKEDIDGALVGGAALKEET
FAPIAKFS
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgattaagacagtaaaaaccgtagaccttaaaggcaagcgggttatcatgcgggtggac
ttcaatgtccccatgaaggacggggtcgtacaggacgatacccgcatcacggcggctatt
cccactatcaagtacattctgggccagggcgtcaaaacccttaccctcatgagccatttg
ggggatccttccaaggacgccgaaaaagccaagggcaaggccgaaaaagacggcaagacc
tttgacctcgacaagtacatcaagggcaagcaccgcatggcgcctgtggccgcctatttg
tcgaagaagctcaaactgcccgtggtcttcgcaggcgaggatagctgctacggcaagaag
gccctcatcgactcccagaagcccggcaccatcatcatgctcgaaaacacccgcttccat
aaggaagaaacttccaaagatgatgcacagcgggacaagctcgccaaggcccttgccgaa
tacggcgatatttttgtgaacgatgccttcggcactgcccacagggatcacgcttccacc
gcttccattgccaagttcgtaccggtttcagtggcgggcttcctcatggaaaaagaagtg
aactaccttgaacccattgttaccaaccctgtgaaacccctggtggccataatcggcggc
gcaaaggtgtcgtccaaaatcgcggttctggaatccctcctcaagaatgcctcggcactc
gtcataggcggaggcatggcctataccttcctcaaggcccagggcaaaaagatcggcaag
tcccttgtcgaagatgatcagatagacactgccaaaaagatcctcgaaaccgccaagaaa
gtgggcgcagaaatagtgctgcccgtggatcatgtcggggccgataaattcgacgccgca
gcagaacctgtagcggtggataatgtaaacctcccggcgaagctcatgggccttgacgtg
ggtcccaagaccattgccaagtacaaggaagttctttccaaggccaagactatagtgtgg
aacggccctgtaggggtttttgaattcgacgcctttgctaagggaaccgaagcggttgcc
aaacttgtggcggaagccacagcccgcggtgctatcactgttgtaggcggcggtgactcg
gtggcggcggtcaacaaattcggccttgcctccaagatgagccatgtgtccacaggcggc
ggcgcttccctcgaactcctggaaggcaaaaaacttcccggcatcgaagttacccgttcc
cgggattacttcatcgccggaaactggaaaatgcacaagacccgcgccgaagcggcggcc
cttgccaaagccctggtaaaagccctcaagcccgggaagcacaagtacctggtggccccg
acttttaccgccctcgaaacagtgggcgcaattgtcaaaggtaccaacatcttgctgggc
gcccagaactgcgcccccgaagaacaaggcgcccatacgggcgaagtatccgtactccag
cttaaggatctcggcgtcgacgccatcattctgggccacagcgagaggcggcacatttac
aaggaagacgacacccttatcaacaagaaggtaaagctggccctgaagcacggttttgaa
gtcatactctgcgttggcgagcttctcgaagaaagagagaagggaaaggccgaagcggtg
tgcaaacgccagactgaaaagggcctcgccggtgttacccccgaggaactttcaaagatc
accattgcctacgagcctgtatgggccatcggtaccggcaagaccgcaactcctgatgat
gccgaagccattcacgcctacatacgcagcgtgatcgccaagctttacggggcccaggct
gcaaaacagatagtcattcagtatggcggatcggttaaggcagagaacgcggcccagctt
atggccaaggaagacatagacggcgcccttgtgggcggcgctgccctcaaagaagagacc
tttgcgcccatagcgaagttcagctaa

DBGET integrated database retrieval system