KEGG   Treponema azotonutricium: TREAZ_3452Help
Entry
TREAZ_3452        CDS       T01506                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
taz  Treponema azotonutricium
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:taz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TREAZ_3452
   01230 Biosynthesis of amino acids
    TREAZ_3452
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TREAZ_3452
   00030 Pentose phosphate pathway
    TREAZ_3452
   00051 Fructose and mannose metabolism
    TREAZ_3452
   00052 Galactose metabolism
    TREAZ_3452
  Energy metabolism
   00680 Methane metabolism
    TREAZ_3452
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    TREAZ_3452
Enzymes [BR:taz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TREAZ_3452
Protein phosphatases and associated proteins [BR:taz01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TREAZ_3452
Messenger RNA biogenesis [BR:taz03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     TREAZ_3452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2730120..2731226)
Genome map
AA seq 368 aa AA seqDB search
MGKLRASVTKTFGILTAGGDCPGLNAAIRGVCRAAHDRYNMTALGIAYGFRGLIEGDSRV
LSPDDFSGILTRGGTILGAGREKPFKAPPAHGDTEVSLDKVEAIKENYRQLGLDCLVILG
GNGTNTTGYLLAREGLNVVGLPKTIDNDIVGTDRAFGFNSALAIGTEAIDRLHSTAQSHS
RVMVIELMGHKAGWLALYAGVAGGGDIILIPEIPYDIKVIGRHLEDRARDGKTFSIVVVA
EGALSIVEDKMDKKEKKKYRSETVTPSIAYRVAREIEAETGMETRATVLGYVQRGGIPSA
SDRVLATSLGTAAADLLARGEYGRMVALSGDGISSVDLSVPAGKVKTVPRDHYMVDTAVS
VGTCMGVE
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagctcagggccagcgtcacaaagaccttcgggatactcaccgcgggcggggat
tgccccggcctcaacgccgccatcaggggggtttgcagggcagcccatgaccgctacaac
atgacagccctcggcatcgcctacggtttcaggggcctcatcgaaggggattcccgggtt
ttgagccccgatgacttttcgggcatcctcacccggggggggactattttgggcgcgggc
agggaaaaacctttcaaggcgccccctgcccatggggatacggaagtcagccttgacaag
gtggaagccatcaaggaaaactaccgccagctcggcctcgactgcctggtgattcttggc
ggcaacggcacaaacaccacaggctacctcctggcgcgggagggcctcaacgtggtgggg
cttcccaaaaccatcgacaacgacattgtgggcaccgaccgcgccttcggtttcaattcg
gccctggccatcggcaccgaagccatagaccgcctccactccactgcccagagccacagc
cgcgtgatggtcatagaactcatgggccacaaggctggctggcttgccctctacgcaggc
gtcgcgggcggcggggacatcatcctcatccccgaaatcccctacgacatcaaggtcata
ggcaggcaccttgaagatcgcgccagggatggcaagaccttttccatcgtggtagtcgcc
gaaggcgccctttcaatcgtcgaggacaaaatggataaaaaggaaaagaagaagtaccgc
tccgaaactgttaccccctccatagcctaccgtgtcgccagggagatagaagcggagacc
ggcatggaaacccgtgccacggttttgggctatgtccagcgcggcggcataccctccgcc
tcggaccgggtgcttgcaacgagccttggcactgccgctgcggacttgctggcccgcggc
gagtacggccgcatggtggccctttcgggtgacgggatttcttcggtggatttaagcgtc
cctgcggggaaagtcaaaaccgtgccgagggatcactatatggtggatactgcggtttcc
gtggggacctgcatgggggttgagtaa

DBGET integrated database retrieval system