KEGG   Treponema azotonutricium: TREAZ_3452Help
Entry
TREAZ_3452        CDS       T01506                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
taz  Treponema azotonutricium
Pathway
taz00010  Glycolysis / Gluconeogenesis
taz00030  Pentose phosphate pathway
taz00051  Fructose and mannose metabolism
taz00052  Galactose metabolism
taz00680  Methane metabolism
taz01100  Metabolic pathways
taz01110  Biosynthesis of secondary metabolites
taz01120  Microbial metabolism in diverse environments
taz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:taz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TREAZ_3452
   00030 Pentose phosphate pathway
    TREAZ_3452
   00051 Fructose and mannose metabolism
    TREAZ_3452
   00052 Galactose metabolism
    TREAZ_3452
  Energy metabolism
   00680 Methane metabolism
    TREAZ_3452
Enzymes [BR:taz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TREAZ_3452
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     TREAZ_3452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AEF80144
UniProt: F5Y7R7
Position
complement(2730120..2731226)
Genome map
AA seq 368 aa AA seqDB search
MGKLRASVTKTFGILTAGGDCPGLNAAIRGVCRAAHDRYNMTALGIAYGFRGLIEGDSRV
LSPDDFSGILTRGGTILGAGREKPFKAPPAHGDTEVSLDKVEAIKENYRQLGLDCLVILG
GNGTNTTGYLLAREGLNVVGLPKTIDNDIVGTDRAFGFNSALAIGTEAIDRLHSTAQSHS
RVMVIELMGHKAGWLALYAGVAGGGDIILIPEIPYDIKVIGRHLEDRARDGKTFSIVVVA
EGALSIVEDKMDKKEKKKYRSETVTPSIAYRVAREIEAETGMETRATVLGYVQRGGIPSA
SDRVLATSLGTAAADLLARGEYGRMVALSGDGISSVDLSVPAGKVKTVPRDHYMVDTAVS
VGTCMGVE
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagctcagggccagcgtcacaaagaccttcgggatactcaccgcgggcggggat
tgccccggcctcaacgccgccatcaggggggtttgcagggcagcccatgaccgctacaac
atgacagccctcggcatcgcctacggtttcaggggcctcatcgaaggggattcccgggtt
ttgagccccgatgacttttcgggcatcctcacccggggggggactattttgggcgcgggc
agggaaaaacctttcaaggcgccccctgcccatggggatacggaagtcagccttgacaag
gtggaagccatcaaggaaaactaccgccagctcggcctcgactgcctggtgattcttggc
ggcaacggcacaaacaccacaggctacctcctggcgcgggagggcctcaacgtggtgggg
cttcccaaaaccatcgacaacgacattgtgggcaccgaccgcgccttcggtttcaattcg
gccctggccatcggcaccgaagccatagaccgcctccactccactgcccagagccacagc
cgcgtgatggtcatagaactcatgggccacaaggctggctggcttgccctctacgcaggc
gtcgcgggcggcggggacatcatcctcatccccgaaatcccctacgacatcaaggtcata
ggcaggcaccttgaagatcgcgccagggatggcaagaccttttccatcgtggtagtcgcc
gaaggcgccctttcaatcgtcgaggacaaaatggataaaaaggaaaagaagaagtaccgc
tccgaaactgttaccccctccatagcctaccgtgtcgccagggagatagaagcggagacc
ggcatggaaacccgtgccacggttttgggctatgtccagcgcggcggcataccctccgcc
tcggaccgggtgcttgcaacgagccttggcactgccgctgcggacttgctggcccgcggc
gagtacggccgcatggtggccctttcgggtgacgggatttcttcggtggatttaagcgtc
cctgcggggaaagtcaaaaccgtgccgagggatcactatatggtggatactgcggtttcc
gtggggacctgcatgggggttgagtaa

DBGET integrated database retrieval system