KEGG   Treponema azotonutricium: TREAZ_3452Help
Entry
TREAZ_3452        CDS       T01506                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
taz  Treponema azotonutricium
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:taz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TREAZ_3452
   00030 Pentose phosphate pathway
    TREAZ_3452
   00051 Fructose and mannose metabolism
    TREAZ_3452
   00052 Galactose metabolism
    TREAZ_3452
  Energy metabolism
   00680 Methane metabolism
    TREAZ_3452
Enzymes [BR:taz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TREAZ_3452
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     TREAZ_3452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2730120..2731226)
Genome map
AA seq 368 aa AA seqDB search
MGKLRASVTKTFGILTAGGDCPGLNAAIRGVCRAAHDRYNMTALGIAYGFRGLIEGDSRV
LSPDDFSGILTRGGTILGAGREKPFKAPPAHGDTEVSLDKVEAIKENYRQLGLDCLVILG
GNGTNTTGYLLAREGLNVVGLPKTIDNDIVGTDRAFGFNSALAIGTEAIDRLHSTAQSHS
RVMVIELMGHKAGWLALYAGVAGGGDIILIPEIPYDIKVIGRHLEDRARDGKTFSIVVVA
EGALSIVEDKMDKKEKKKYRSETVTPSIAYRVAREIEAETGMETRATVLGYVQRGGIPSA
SDRVLATSLGTAAADLLARGEYGRMVALSGDGISSVDLSVPAGKVKTVPRDHYMVDTAVS
VGTCMGVE
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagctcagggccagcgtcacaaagaccttcgggatactcaccgcgggcggggat
tgccccggcctcaacgccgccatcaggggggtttgcagggcagcccatgaccgctacaac
atgacagccctcggcatcgcctacggtttcaggggcctcatcgaaggggattcccgggtt
ttgagccccgatgacttttcgggcatcctcacccggggggggactattttgggcgcgggc
agggaaaaacctttcaaggcgccccctgcccatggggatacggaagtcagccttgacaag
gtggaagccatcaaggaaaactaccgccagctcggcctcgactgcctggtgattcttggc
ggcaacggcacaaacaccacaggctacctcctggcgcgggagggcctcaacgtggtgggg
cttcccaaaaccatcgacaacgacattgtgggcaccgaccgcgccttcggtttcaattcg
gccctggccatcggcaccgaagccatagaccgcctccactccactgcccagagccacagc
cgcgtgatggtcatagaactcatgggccacaaggctggctggcttgccctctacgcaggc
gtcgcgggcggcggggacatcatcctcatccccgaaatcccctacgacatcaaggtcata
ggcaggcaccttgaagatcgcgccagggatggcaagaccttttccatcgtggtagtcgcc
gaaggcgccctttcaatcgtcgaggacaaaatggataaaaaggaaaagaagaagtaccgc
tccgaaactgttaccccctccatagcctaccgtgtcgccagggagatagaagcggagacc
ggcatggaaacccgtgccacggttttgggctatgtccagcgcggcggcataccctccgcc
tcggaccgggtgcttgcaacgagccttggcactgccgctgcggacttgctggcccgcggc
gagtacggccgcatggtggccctttcgggtgacgggatttcttcggtggatttaagcgtc
cctgcggggaaagtcaaaaccgtgccgagggatcactatatggtggatactgcggtttcc
gtggggacctgcatgggggttgagtaa

DBGET integrated database retrieval system