KEGG   Treponema azotonutricium: TREAZ_3601Help
Entry
TREAZ_3601        CDS       T01506                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
taz  Treponema azotonutricium
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:taz00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    TREAZ_3601
  Metabolism of other amino acids
   00480 Glutathione metabolism
    TREAZ_3601
Enzymes [BR:taz01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     TREAZ_3601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2567697..2568176
Genome map
AA seq 159 aa AA seqDB search
MNLYDFTVNDREENPVSLVCCKGKVILIVNSATHCGFTPQYAGLQKLYEEFHDKGLEILD
FPCNQFGKQAPGTAAEICEFRVSHYHTTFPQFAKIEVNGANASPLYVYLKQQLKGICGSN
IKWNFTKFLIDKNGNAVKRYGPNKTPQAIAKDVEAFLNR
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgtatgactttaccgtaaacgatcgtgaagaaaatccggtttctcttgtctgc
tgcaagggtaaagtaattttaattgtgaacagcgctacacattgcggatttacaccgcaa
tatgcagggctgcaaaaattgtacgaagaatttcatgataaaggtcttgaaattcttgac
ttcccctgtaatcaattcgggaagcaagccccggggactgcggcggaaatatgcgaattc
cgcgtttctcattatcacacgacttttccgcagttcgctaaaatagaggtaaacggcgcc
aacgcctcgcccctgtatgtgtatttaaaacaacagcttaaaggcatttgcggctcaaac
atcaaatggaatttcaccaaatttcttattgataaaaacggaaacgccgtaaaacgctac
gggccgaataaaacaccccaggcgatcgccaaggatgtggaagcatttttgaaccggtag

DBGET integrated database retrieval system