KEGG   Thermococcus barophilus: TERMP_00026Help
Entry
TERMP_00026       CDS       T01377                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
tba  Thermococcus barophilus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TERMP_00026
   00030 Pentose phosphate pathway
    TERMP_00026
   00051 Fructose and mannose metabolism
    TERMP_00026
   00052 Galactose metabolism
    TERMP_00026
   00500 Starch and sucrose metabolism
    TERMP_00026
   00520 Amino sugar and nucleotide sugar metabolism
    TERMP_00026
  Nucleotide metabolism
   00230 Purine metabolism
    TERMP_00026
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TERMP_00026
Enzymes [BR:tba01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     TERMP_00026
    5.4.2.8  phosphomannomutase
     TERMP_00026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
23321..24721
Genome map
AA seq 466 aa AA seqDB search
MSKTKKVMKMGKLFGTFGVRGIANEKITPEFALKIGMAFGTLLKREQPDKELWVVVGRDT
RVSGEMLKNALISGLLSVGVNVIDVDIAPTPAIQFACRYFGVDGGAVITASHNPPEYNGI
KLLEPNGLGLKKEREAVVEELFFKEEFDMAKWHEIGSLEKRDIIRPYINAIKSKVDVEAI
KRRKPFVVVDTSNGAGSLVLPYLLRELGCKVVSVNAHPDGHFPARNPEPNEENLQGFMKI
VKSLGADFGVAQDGDADRSVFIDENGNFIQGDKTFALIVKAMLQEHGGGLVVTTIATSHI
IDELAKQYGGKVLKTKVGDLIVSRALLEHNGLVGGEENGGVIFPDHVLGRDGAMTVAKIV
EIFARSGKKFSELINELPKFYQVKTKRHIEGDRHVIVEKVAKIAEQKGFKIDTTDGTKIL
FDDGWVLVRASGTEPIIRIFAEARSEEKAKEYLDLGLGLLDEALNT
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaacaaaaaaggtgatgaaaatgggaaagctgtttggaacatttggagtaagg
ggaattgcgaatgaaaagataaccccagaatttgcccttaagatagggatggcatttgga
actttgctgaaaagagagcagccggacaaagaactttgggttgtcgtgggaagggacaca
agagtaagcggtgaaatgctaaaaaatgcattaatttctggacttctaagtgtcggagtg
aacgttattgatgtggacattgctccaacccctgcaattcagtttgcatgcagatacttt
ggagttgacggcggggcagtaattactgcatcccacaaccctccagaatacaatggaatt
aagcttttggaaccaaatgggttgggcttaaagaaggagagggaggctgttgtggaggag
ttattcttcaaagaagaattcgacatggcaaagtggcatgaaattggcagtttagaaaag
agagacataataagaccttacatcaatgcaataaagtctaaggttgatgttgaagcaata
aagaggagaaagccctttgtggtggtcgacacttcaaacggtgcaggctcgttggttctg
ccctacctactcagggagcttggatgcaaagtggtcagcgtgaatgctcatccagatgga
cacttcccggcaagaaatccagagccaaatgaagagaatctgcagggattcatgaagatt
gtcaaatcgttgggggcagattttggtgttgctcaagacggggatgcagaccgttcagtg
ttcattgatgagaatggaaacttcattcagggagataaaacgtttgccctcattgttaag
gcaatgcttcaagaacatggcgggggcttggttgttacaacaatagcaacctcacacata
attgatgagctcgcaaagcagtatggaggaaaagtactcaagacgaaggttggagatttg
atagtttcaagagctttgcttgagcacaacggactggttggaggagaggagaacggtggt
gtaatctttccggatcatgtcttgggcagagatggagcaatgaccgtggcaaagatagtt
gagatatttgcaaggagcggaaagaagttcagcgagctcattaacgagcttcccaagttc
tatcaggtgaagacaaagaggcatattgagggagataggcatgtgatagttgaaaaagtc
gccaaaattgcggagcagaagggctttaagatcgacacaacagatggaacaaagatcctc
tttgacgatggctgggttttggttagagcaagcggaacagagccaataataaggattttc
gcagaggcgaggagcgaagagaaggctaaagaatatcttgatttgggactgggtcttttg
gatgaggctttgaatacctga

DBGET integrated database retrieval system