KEGG   Thermococcus barophilus: TERMP_00157Help
Entry
TERMP_00157       CDS       T01377                                 

Definition
(GenBank) tryptophan synthase like beta chain
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tba  Thermococcus barophilus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tba00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TERMP_00157
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TERMP_00157
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TERMP_00157
Enzymes [BR:tba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TERMP_00157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(125823..127163)
Genome map
AA seq 446 aa AA seqDB search
MEKVKAVLKPEEMPKKWYNILPDLPEPLAPPLDQETDKPINPEKLKRIFAEELVKQEMSS
KRFIEIPEEILEVYIKIGRPTPLFRATHLEKALKTPARIYFKYEGATITGSHKINTALAQ
AYYAKNQGIERLVTETGAGQWGTALSLAGALFGLKIRVYMARASYQQKPYRKILMQTYGA
EIYPSPSDRTSIGRKFLAQDPNHPGGLGIAISEAIEDVLNDENARYSLGSVLNHVLMHQT
IIGEEARLQMELLDEEPTTIVGCVGGGSNFAGLAYPFVRDVLKGKAGYEFYAIEPRAAPS
MTRGVYTYDYGDSGRLTPKIKMHTLGHTYYVPPIHAGGLRYHGLAPTLSILINHGIVKPK
AYHQTEIFEAAVLFARTEGIVPAPESAHAVKGVIDLALKAKENGEKKVILFNLSGHGLLD
LKGYEDFLEGRLNDYEPKEFPILEGS
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaggttaaagccgttttgaagccagaagaaatgccaaagaagtggtacaacatt
ttgcccgatttgccagagccgctggctccgccattagaccaagaaacagataagccaata
aatccagagaagctgaagagaatttttgctgaagagttagttaagcaggaaatgagcagt
aaaaggttcattgaaataccggaggaaattttagaggtgtatattaagattggaagacca
accccgcttttcagggcaacacacttggaaaaagctctcaaaacaccagcaaggatttac
ttcaagtatgaaggagcaacgataacaggaagtcacaaaataaacactgccttagcccaa
gcttattatgctaaaaatcaaggtattgagaggttagtcactgaaactggtgcaggtcag
tggggaacagctctatctttagcgggagctctgtttgggctgaaaattagggtgtacatg
gcaagggcaagctatcagcagaagccttacagaaaaatactaatgcaaacctatggagca
gagatttatccatcaccaagcgacagaacaagcattggaaggaagtttttagctcaagac
cccaatcatccagggggattggggatagcaataagtgaagctatagaagatgttttgaat
gacgaaaatgcccgctactcacttggtagtgttttaaatcacgttttaatgcatcagaca
attattggagaggaagcaaggcttcaaatggagctgcttgatgaagagccaacaacaata
gtcggctgtgttggaggtggaagcaactttgctggcttagcttatccgttcgttagagat
gttttgaaaggcaaagcaggatatgagttctatgcgatagagccgagagcagcaccctca
atgacaagaggagtttacacttacgactatggagacagcggaaggctaacgccgaagata
aagatgcacaccttgggacacacctattatgttcccccaattcatgctggagggctgaga
tatcacggcttagctccaacactgagcattctaataaaccacggtatagtaaagcctaag
gcgtatcatcaaacggagatatttgaggcggcagttctatttgcaagaaccgaaggtatc
gttccagcaccagaaagtgcccatgcggtgaaaggcgtaattgacttagcattaaaagca
aaagaaaatggagagaagaaagttatcctattcaatctaagcggacatggattgcttgac
cttaaaggatacgaggacttccttgaaggaagacttaatgactacgaacccaaggagttt
ccaattttagaaggctcttaa

DBGET integrated database retrieval system