KEGG   Thermococcus barophilus: TERMP_00226Help
Entry
TERMP_00226       CDS       T01377                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tba  Thermococcus barophilus
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tba00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    TERMP_00226
Enzymes [BR:tba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     TERMP_00226
Exosome [BR:tba04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TERMP_00226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
181949..183430
Genome map
AA seq 493 aa AA seqDB search
MGKFILSLDEGTTSARAIIFDRESSILGVGQYEFPQYYPKPGWVEHNPEEIWDAQLRAIK
TALKNAKITPEQIAAIGVTNQRETTIIWDKNGKPVYNAIVWQCRRTAEMIEDIKRNYGEM
IREKTGLVPDAYFSASKIKWLLDNVPGLREKAQKGEVMFGTVDTFLIYKLTGKHVTDYSN
ASRTMLFNIKKLEWDEELLEIFGIPDAILPEVKESSEIYGYTKKELFGVEIPVSGDAGDQ
QAALFGQACFDEGMVKATYGTGNFILVNTGDKIKYSQNLLTTIAWGLNGNISYALEGSVF
ITGAAVQWLRDGLKIINSAAETEELASKLASNDGVYFVPAFVGLGAPYWDQFARGLIIGI
TRGTTREHFARATLEAIAYLTKDVIGEMEKEVPIKELRVDGGATKNNFLMQFQADILGKT
VIRPVVQETTALGAAYLAGLAVGYWESLEEIGELWKVEKVFEPKMNEKEREKLYRGWKEA
VKRALGWARILGV
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagtttatactttctcttgatgaaggaactacgagtgcaagggcgataatcttc
gacagggaaagtagcatcttgggggttggacagtatgagtttcctcagtattacccaaag
cccggctgggttgaacataatcctgaagaaatctgggatgctcagcttagggccataaaa
acagccttaaaaaatgccaaaattactccagagcagatagcggcaattggagtaacaaat
cagagggaaacaacgataatctgggacaaaaatggaaagcccgtttacaacgctattgtc
tggcagtgcagaagaaccgcggagatgattgaagacattaagagaaattatggagagatg
ataagggaaaaaaccggtttagttccagatgcatacttctcagcatcaaagataaagtgg
ctccttgacaacgttccgggtttaagagaaaaagctcagaaaggagaagtgatgtttgga
acagttgacactttcttgatttacaagcttacagggaagcatgttactgactattcaaat
gcctcaagaactatgctcttcaacatcaagaagcttgagtgggatgaggagcttttggaa
atcttcggaattccagatgcaattctgcccgaggttaaggaatcaagtgagatttatggt
tatactaaaaaagagctgtttggtgttgagattccagtaagcggagatgctggggatcag
caggcagctcttttcggtcaggcatgttttgatgaagggatggtgaaagcaacatatggc
actgggaacttcatactcgtaaatacgggagacaaaataaagtattcccaaaaccttctc
acgaccatagcttggggattgaatgggaacatcagctatgcccttgagggaagcgttttt
ataaccggcgcagctgtccagtggcttagggatgggttaaaaattatcaatagtgcagct
gaaactgaggaacttgcatcaaagttagcatcaaatgatggagtttactttgtgccagcc
tttgtcggtctcggtgctccttactgggatcagtttgcaaggggtttgataattggtata
acaagaggcactacaagggagcactttgcgagggctacgcttgaggcgatagcgtatctc
acgaaagatgtgataggtgagatggagaaggaagttccaatcaaagagcttagggttgat
gggggagcaaccaagaacaacttcctcatgcagttccaagctgatatcttgggaaagaca
gtcataagacctgttgttcaagagacaaccgctttgggagctgcatatctggctggtttg
gcggtgggttactgggaaagcttagaggaaattggggaactttggaaagttgaaaaagtg
tttgagccgaagatgaatgagaaagagagggaaaagctctatagaggctggaaagaagcc
gtaaagagagccttagggtgggcgaggattctgggagtctaa

DBGET integrated database retrieval system