KEGG   Thermococcus barophilus: TERMP_00438Help
Entry
TERMP_00438       CDS       T01377                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
tba  Thermococcus barophilus
Pathway
tba00340  Histidine metabolism
tba01100  Metabolic pathways
tba01110  Biosynthesis of secondary metabolites
tba01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tba00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    TERMP_00438
Enzymes [BR:tba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     TERMP_00438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh LUD_dom She9_MDM33
Motif
Other DBs
NCBI-ProteinID: ADT83415
UniProt: F0LJE9
Position
complement(362846..363979)
Genome map
AA seq 377 aa AA seqDB search
MNLELESYVAQILKDIRERGIEAVKEYSRKFDGYDGEFLVSEKEFEEAERQIPEKDKEII
KRTIERIRFYHEKQLESDKLYIKNASLYGIIYKPIRRIGIYVPGGKPLPSTLIMAGVPAK
VAGVKEIAVTTPPKNGKINPYILYVAKLLGIEEVYKLGGIQAIGAMAYGIGMKKVDKIFG
PGNRFVNEAKRQVFGVVGIDSLAGPSEIAVIADETANKEYVLYDLLSQLEHGKGSKAWLL
TTSKELAEYCRKNGIEVVVCESLEECAEKANEIAPEHLEIITKEPLKLVDLIENAGAIYL
GEYTPVPAADYFLGVNHVLPTGGAAKFSGVLTVMDFMKRISLAYVSREEFLSERYLGIRL
AEIEGMEMHRKSMEVRR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttgagttagaaagctatgtggctcaaattttgaaagacataagggaaaggggt
attgaagctgtaaaggaatactcaaggaagtttgacggctatgacggggaattccttgtt
agtgagaaggagtttgaagaagcggagaggcagattccagagaaagataaagagataatc
aagcgcacaatagaaagaatccgcttttaccacgagaaacagcttgagagcgataagctc
tacataaagaacgcttcgctttacggcataatctacaagccgataaggagaatcggtatc
tatgtccccggaggaaaacctctgccttcaacgctcatcatggctggagttccagcaaaa
gtagcaggtgttaaggagatagcggttacaacaccacctaaaaacggcaaaatcaatccg
tacatcctgtatgttgcaaagcttctcggcatcgaagaggtttacaagctcggtggaatt
caagcgattggggcaatggcttacggcattggaatgaagaaggtagacaaaatcttcggt
ccaggcaataggttcgtgaatgaagcaaagaggcaggtctttggtgttgtaggaattgac
agcttagctggaccatcggagatagctgttatagccgacgagacggcaaataaggagtat
gttttatacgatttgctttcccagctggagcacggaaaaggcagcaaagcttggctttta
acgacttcaaaggaattagcggagtactgcagaaagaatggaattgaagttgtcgtgtgt
gaaagcttggaggagtgcgccgaaaaagctaacgagatagctccagaacacttggagata
atcacgaaggaaccgctgaagctcgtagatttaattgaaaatgctggagctatctacttg
ggagaatacacaccggtgccagctgctgactatttccttggagttaaccacgttctgcct
acagggggagcagcaaagttcagtggggttttaacagtcatggacttcatgaagagaata
agcttagcctacgtaagcagagaagaatttctaagcgagcgctatcttggaattcggctt
gcagagatagagggaatggagatgcacaggaaatcgatggaggttagaagatga

DBGET integrated database retrieval system