KEGG   Thermococcus barophilus: TERMP_00438Help
Entry
TERMP_00438       CDS       T01377                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
tba  Thermococcus barophilus
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tba01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:tba00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(362846..363979)
Genome map
AA seq 377 aa AA seqDB search
MNLELESYVAQILKDIRERGIEAVKEYSRKFDGYDGEFLVSEKEFEEAERQIPEKDKEII
KRTIERIRFYHEKQLESDKLYIKNASLYGIIYKPIRRIGIYVPGGKPLPSTLIMAGVPAK
VAGVKEIAVTTPPKNGKINPYILYVAKLLGIEEVYKLGGIQAIGAMAYGIGMKKVDKIFG
PGNRFVNEAKRQVFGVVGIDSLAGPSEIAVIADETANKEYVLYDLLSQLEHGKGSKAWLL
TTSKELAEYCRKNGIEVVVCESLEECAEKANEIAPEHLEIITKEPLKLVDLIENAGAIYL
GEYTPVPAADYFLGVNHVLPTGGAAKFSGVLTVMDFMKRISLAYVSREEFLSERYLGIRL
AEIEGMEMHRKSMEVRR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttgagttagaaagctatgtggctcaaattttgaaagacataagggaaaggggt
attgaagctgtaaaggaatactcaaggaagtttgacggctatgacggggaattccttgtt
agtgagaaggagtttgaagaagcggagaggcagattccagagaaagataaagagataatc
aagcgcacaatagaaagaatccgcttttaccacgagaaacagcttgagagcgataagctc
tacataaagaacgcttcgctttacggcataatctacaagccgataaggagaatcggtatc
tatgtccccggaggaaaacctctgccttcaacgctcatcatggctggagttccagcaaaa
gtagcaggtgttaaggagatagcggttacaacaccacctaaaaacggcaaaatcaatccg
tacatcctgtatgttgcaaagcttctcggcatcgaagaggtttacaagctcggtggaatt
caagcgattggggcaatggcttacggcattggaatgaagaaggtagacaaaatcttcggt
ccaggcaataggttcgtgaatgaagcaaagaggcaggtctttggtgttgtaggaattgac
agcttagctggaccatcggagatagctgttatagccgacgagacggcaaataaggagtat
gttttatacgatttgctttcccagctggagcacggaaaaggcagcaaagcttggctttta
acgacttcaaaggaattagcggagtactgcagaaagaatggaattgaagttgtcgtgtgt
gaaagcttggaggagtgcgccgaaaaagctaacgagatagctccagaacacttggagata
atcacgaaggaaccgctgaagctcgtagatttaattgaaaatgctggagctatctacttg
ggagaatacacaccggtgccagctgctgactatttccttggagttaaccacgttctgcct
acagggggagcagcaaagttcagtggggttttaacagtcatggacttcatgaagagaata
agcttagcctacgtaagcagagaagaatttctaagcgagcgctatcttggaattcggctt
gcagagatagagggaatggagatgcacaggaaatcgatggaggttagaagatga

DBGET integrated database retrieval system