KEGG   Thermococcus barophilus: TERMP_00454Help
Entry
TERMP_00454       CDS       T01377                                 

Definition
(GenBank) NAD(P)-dependent glyceraldehyde 3-phosphate dehydrogenase
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
tba  Thermococcus barophilus
Pathway
tba00010  Glycolysis / Gluconeogenesis
tba01100  Metabolic pathways
tba01110  Biosynthesis of secondary metabolites
tba01120  Microbial metabolism in diverse environments
tba01130  Biosynthesis of antibiotics
tba01200  Carbon metabolism
tba01230  Biosynthesis of amino acids
Module
tba_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tba_M00002  Glycolysis, core module involving three-carbon compounds
tba_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TERMP_00454
Enzymes [BR:tba01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     TERMP_00454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N 2-Hacid_dh_C GFO_IDH_MocA NAD_binding_3 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ADT83431
UniProt: F0LJG5
Position
complement(377490..378494)
Genome map
AA seq 334 aa AA seqDB search
MKVKVGINGYGTIGKRVAYAITKQDDMALIGVTKTKPDFEAYRAKELGIPVYAASEEFLP
RFEKAGFEVAGTLEDLLQKVDVIVDATPGGMGAKNKPIYEKYGVKAVFQGGEKADVAEVS
FVAQANYEKALGKSYVRVVSCNTTGLTRTLSAIQEYIDYVYAVMIRRAADPNDIKRGPIN
AIKPTVEVPSHHGPDVQTVIPINIETTAFVVPTTIMHVHSIMVELKKPITKKDVIDIFEN
TTRVLLFEKEKGFDSTAQLIEFARDLHREWNNLYEIAVWKESINVKGNRLFYIQAVHQES
DVVPENIDAIRAMFELADKWESIKKTNNSLGILK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagttaaggtgggaattaacggttacgggacaatagggaagagagtagcttacgct
atcacaaagcaagatgatatggcacttataggtgtaacaaagacaaagccagacttcgaa
gcttacagggcaaaggagctcggcattccagtatatgcggcatcagaggaatttttgcca
aggtttgaaaaagccggctttgaagttgccggaactttagaagatttgcttcaaaaagtt
gatgttatcgttgatgcaactccagggggaatgggggcgaagaataagccgatttatgaa
aagtatggggttaaggcagtgtttcaaggtggagaaaaggctgatgttgcggaggtttcc
ttcgttgctcaggcaaattatgagaaagctctcggaaagagctacgttagagtggtttcg
tgcaacacaaccggattaacaaggacgctaagtgcgattcaagagtacattgactacgtt
tacgctgtgatgattaggagagctgctgatcctaatgacatcaagaggggtccaatcaac
gcaataaagccaaccgttgaagttccatcccatcacgggccagatgttcaaacagttatt
ccaataaacattgagacgacagcttttgttgtgccaacgacgataatgcacgtccactca
ataatggttgagctgaagaagccaatcaccaagaaagatgtaatcgatatctttgagaac
accacgagggttctgctctttgaaaaagagaaagggtttgatagcactgcccagctgata
gaatttgcaagggatttacacagagaatggaacaacctctacgaaatagctgtctggaag
gagagcataaacgttaagggcaacaggctgttctacattcaagcagttcatcaggagagc
gacgttgtaccagagaacatcgacgcaatcagagcaatgtttgaattagctgataagtgg
gagagtataaagaagacgaacaatagcttgggaattttgaagtga

DBGET integrated database retrieval system