KEGG   Thermococcus barophilus: TERMP_00518Help
Entry
TERMP_00518       CDS       T01377                                 

Definition
hypothetical protein
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tba  Thermococcus barophilus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tba01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:tba00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(433057..434373)
Genome map
AA seq 438 aa AA seqDB search
MMELLSQLIEFETVNDPAKGKKPNKECPKFIKDALASWGIESEIIEEDGYYTVYGEIGEG
TPKVMFMAHFDVVPVNVEEWKTDPFKLTVIGNKAYGRGSADDKGNVAGVMLALKELSTKR
LSGKVLFAFTGDEEIGGKLAMHIAEKLKEENKIPQYLINADGAGMSPIIRRRKGFGAVIE
IPQQKITIRGRVIKKSFTISTPVLQTRHAAYFMPGVDAHPMIALSHFLRNNDVFAVKLGG
KFLKSNVLPSRVELTYVEPDESGEEIEVDLGLTELLKSIVPLVRAPISAERYSDFGVSIT
PNLYSFENGVHRLRLDIRAMSYSSGQIEKVLKEILEFNIPNAKLTVRHNEKAGYLFTSPD
SKLVRVMMKILESFGEKAKPVEGAGASDSRYFTPYGVEAIDFGPRGGNVHGPNEYADVSS
LELLPKIYAEVAMNLLKK
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgatggaattattgtcccagctgattgaatttgaaaccgtaaatgacccagccaaagga
aagaagccaaacaaagagtgtccaaagtttatcaaagacgctcttgcctcttggggaata
gagagcgagataattgaggaagatggatactacactgtttacggtgaaattggagaagga
acaccaaaggtcatgttcatggcacactttgatgtcgttccagtgaatgtagaggaatgg
aagaccgatccgtttaagctgactgtaatcgggaacaaagcctatggaaggggaagtgca
gatgacaaaggcaacgttgctggggtaatgctcgctctaaaggagctttcaacaaaaagg
ctcagtgggaaagtgctttttgcttttactggagatgaagaaatcggcggcaaattggca
atgcacatagcggaaaagctgaaggaggagaataagatcccacaatatttaatcaacgcc
gatggggctggaatgagcccaataatcaggagaagaaagggatttggggctgtaattgaa
ataccccagcagaaaattacaattagaggcagagttataaaaaagtcattcaccataagc
acacccgtacttcaaacaagacatgccgcctacttcatgcctggtgtagatgctcaccca
atgattgccctttctcacttcctaaggaacaacgatgtctttgctgtgaaattggggggt
aaattcctgaagtcaaacgttctgccaagcagagttgagctgacatatgtggaacctgat
gaaagtggggaagagattgaggtagatttgggcttaacagagcttttaaagagcatagtt
ccgttagttagagccccgataagtgctgaaagatacagcgactttggagtttcaataacc
cccaacttatattcatttgaaaatggggttcataggctcagacttgatataagggcgatg
agctactcctctgggcagatagaaaaagtgcttaaggaaattttagagtttaacattcca
aatgcaaagctgactgttagacacaatgaaaaagctggctatttatttacatcaccagat
tcaaagcttgttagggtaatgatgaaaatcttagaaagctttggagagaaagccaaacct
gttgaaggtgctggggcatcagattcgaggtatttcactccctatggtgttgaagcaata
gattttggaccgagaggaggaaatgttcatggacctaatgaatatgccgatgtgagttct
cttgaactgctacccaaaatttatgcagaggttgcaatgaacctgcttaaaaagtga

DBGET integrated database retrieval system