KEGG   Thermococcus barophilus: TERMP_00768Help
Entry
TERMP_00768       CDS       T01377                                 

Definition
acetyl-CoA synthetase subunit beta
Orthology
K01905  
acetyl-CoA synthetase (ADP-forming) [EC:6.2.1.13]
Organism
tba  Thermococcus barophilus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TERMP_00768
   00620 Pyruvate metabolism
    TERMP_00768
   00640 Propanoate metabolism
    TERMP_00768
Enzymes [BR:tba01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     TERMP_00768
Lipid biosynthesis proteins [BR:tba01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TERMP_00768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
674984..675682
Genome map
AA seq 232 aa AA seqDB search
MDRVSKAREIIEKAKAEGRPLVEPEAKEILKLYGIPTPDFKVARNEEEAVKFAREIGYPV
VMKIVSPQIIHKSDAGGVKINIKNDDEAREAFRTIMENAKRYKPDADLWGVIIYKMLPLG
KEVIVGMIRDPQFGPAVMFGLGGIFVEILKDVSFRVAPITKEEALEMIKEIKAYPILAGA
RGEKPVNIEALADIIVKVGELALELPEVKELDINPIFAYEDEAVAVDARMLL
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggatagggtttcaaaagcaagggaaattatcgaaaaagccaaggctgagggcagacct
cttgtagaaccagaggctaaggagattctcaagctctacggcattccaaccccagatttc
aaggttgcaagaaatgaggaggaagccgttaagtttgcaagggagattggttatccagtt
gtcatgaagattgtctcaccacagatcatccacaagagcgatgccggcggtgttaagatt
aacatcaaaaacgatgatgaagcaagagaagccttcagaacaatcatggaaaatgcaaag
agatacaagccagatgcagatctttggggtgttataatctataagatgcttccactcgga
aaggaagttatcgttggtatgattagagacccacagtttggtccagctgtcatgtttggt
cttggtggtatcttcgttgagattcttaaggatgtcagctttagagttgctccaataaca
aaggaagaagcacttgaaatgattaaagaaatcaaggcttacccaattcttgccggtgca
agaggagaaaaaccagtaaacattgaggctttggcagacataattgttaaagttggtgaa
ttggccctcgagcttccagaagtcaaagagcttgacatcaacccaatctttgcttatgag
gatgaggcagttgcagttgacgcaagaatgctactttga

DBGET integrated database retrieval system