KEGG   Thermococcus barophilus: TERMP_00788Help
Entry
TERMP_00788       CDS       T01377                                 

Definition
tungsten-containing formaldehyde:ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tba  Thermococcus barophilus
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tba01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:tba00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
687774..689636
Genome map
AA seq 620 aa AA seqDB search
MKGWWGRILRVDLTNNKVKVQEYSPEIAQLFIGGRGLAAKILWDEVKGVDPLSPENKLVI
AAGPFNGLPTPSGGKLVVAAKSPLTGGYGDGNIGTMATVHLRKAGYDAIVIEGKAKKPVY
LYVEDDNVSILSAEGLWGLDTFKTEEELKKIHGKNVGILSIGPGGENLVKYAVIMSQEGR
AGGRPGIGAVMGSKKLKAVVIKGTKEIPVADKEELRKLSKEAYDEILSKPTYEFWHRQGT
MAAVEWTNENSALPTYNFQDGSFKFARSIDGYTLEGMKVKQRGCPYCNMPCGNVVLDAEG
LESELDYENVALLGSNLGIGQLNKVAVLNRLADMYGLDTISLGGSIAFVMEAVEKGLLKE
GPTFGDYKGAKELVKEIAFRSSELGNFAAEGVMRMAQKVEGGENFAMHVKGLEVSGYNSY
IYPAMALAFATSSIGAHHKEAWVIAWEIGTAPIEGEQAKKVEYKITYSPEKAAKVIELQR
YRGGLFEMLSACRLPWIEVGLSIDYYPKLLKAITGVTYTWDDLFAAADRLYALIRAYWVR
EFNGNWSRRMDYPPKRWFIEGLKSGPYKGKHLEEDKYDKLLSEYYKMRGWDERGIPTKET
LQKLKLDFVIPELEKVTELH
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggttggtggggaagaattttaagagtcgatttaacaaacaacaaagtcaaagtg
caggaatattctccagaaattgctcaactcttcatcggtggaaggggattggcagcaaag
attctctgggatgaagtcaagggagttgatcctcttagcccagaaaacaagcttgtcata
gctgctggaccatttaacggccttccaacgccaagcggaggaaaattggttgttgcagct
aagagtccacttactgggggatatggggacggaaacataggaacaatggcaactgtgcat
cttagaaaggctggttatgatgccattgttattgaaggaaaagccaaaaagcccgtgtat
ctttacgttgaagatgataatgtaagtattctcagtgctgaaggattgtggggtcttgac
acctttaagacagaagaagagctgaagaagatccacggcaagaatgtgggcatattaagc
attggaccgggtggcgagaatttagtgaaatatgcagttataatgtcacaagaaggaaga
gctggaggaagacccggtattggtgcagtaatgggaagcaagaagctcaaggctgttgta
attaaaggaacaaaggaaattccagtggcagataaagaagagttaagaaaactaagcaaa
gaggcttatgatgagatattgagcaagccaacctatgagttctggcaccgtcagggaacg
atggcagctgtagaatggacaaatgaaaactcagcacttccaacatacaacttccaagac
ggttcattcaagtttgcaagatcaattgatggttacaccctggagggcatgaaggtcaag
cagcgtggctgtccttactgtaacatgccctgtggaaacgttgttcttgacgccgagggc
ttggagagcgagctcgattatgaaaatgtagcattgttgggctcaaaccttgggattgga
cagctcaacaaggttgcagttttgaacagactcgccgacatgtacggtcttgacacaata
tctttgggtggctcaatagcgtttgtcatggaagctgttgagaaaggacttctcaaagaa
ggcccaacattcggagactacaagggagcaaaagaacttgtcaaagagattgcattcagg
agtagcgagcttggaaacttcgccgctgaaggtgtaatgagaatggctcaaaaagtggaa
ggaggagaaaactttgcaatgcacgttaaaggattggaagtaagcggttacaacagttat
atctatcccgcaatggcacttgcatttgcaacatcatcaatcggtgcccaccacaaggaa
gcatgggttattgcttgggaaatcggtacagcaccaattgaaggagagcaggcaaagaag
gttgagtacaagattacatatagcccagaaaaggctgcaaaggttattgagctgcagaga
tacagaggtggactgttcgagatgctctctgcatgtaggttgccatggattgaggttggg
ctaagcattgactattatccaaagctcctgaaggcaataactggagtcacatacacatgg
gacgacctctttgcagcagctgacaggctatatgcattgattagagcttactgggttaga
gagttcaacggaaactggagcagaaggatggactacccaccaaagagatggttcattgag
ggacttaagagcggaccatacaagggcaagcaccttgaggaggacaagtacgacaagctg
ctcagtgaatactacaagatgcgcggctgggacgagagaggaattccaactaaggaaaca
ctccagaagctcaagcttgacttcgtcattccggagcttgagaaggttacggagcttcat
taa

DBGET integrated database retrieval system