KEGG   Thermococcus barophilus: TERMP_00995Help
Entry
TERMP_00995       CDS       T01377                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
tba  Thermococcus barophilus
Pathway
tba00260  Glycine, serine and threonine metabolism
tba01100  Metabolic pathways
tba01110  Biosynthesis of secondary metabolites
tba01120  Microbial metabolism in diverse environments
tba01230  Biosynthesis of amino acids
Module
tba_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tba00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TERMP_00995
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TERMP_00995
Enzymes [BR:tba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TERMP_00995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Peripla_BP_6
Motif
Other DBs
NCBI-ProteinID: ADT83971
UniProt: F0LMJ2
Position
complement(870543..871700)
Genome map
AA seq 385 aa AA seqDB search
MLRCTACGREYSLRKPYQRCECGEPLELKLFEGFAGIGKSVWERFVQFFPFELDLDLSLG
EGDTPLIRARKLSKELGIQLYLKNETVNPTWSFKDRGTFLGIHRALQLGFDKVGTVSTGN
MAASVAAYASRAGLKAYILVSSYIAEEKLKQIAVYGAEVIKVRGDYGKLYYESLNLGQKL
GIYFINSDDPFRIEGYKGISFEIVEEVMPDYVVVPTSSGGLIRGIIKGFLELKKSKLIDK
LPMFVCVQAEGCSPIYKAFIEGKEKIERFENQHTIAHAIENPYPPSGNAVLRLLRKLNGM
CVAVSDEEILKAQRMLAQEGVFVQPASATGIAAVKKLREEGRIKGDERVVSILTGAGLKT
LHQLGRFEVRECEMKRLKDCLVGQI
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcttaggtgtacagcttgcggtagagagtattctctgagaaagccatatcaaaggtgt
gagtgtggagaacctttagagcttaagctttttgaaggctttgctggaatcggaaaaagt
gtttgggaacgttttgttcagttctttccttttgaacttgacttggatttgagcttaggg
gaaggggatactccacttataagagcaaggaagctctcaaaagagctcggaattcagctt
tatttaaaaaacgaaactgttaatccaacttggagctttaaggataggggaacatttttg
ggaatccacagggctttgcagcttggctttgacaaagttggaactgtttcaactggcaat
atggctgcaagtgttgcagcttatgcatcgagagcagggctgaaagcttatattctcgtt
tcttcatacatagcagaggaaaagctcaagcagattgctgtttatggagctgaggttata
aaagttagaggtgattacggaaaactctactatgaaagccttaatcttggacagaagctt
ggcatctacttcataaattctgacgatccattccgtatagagggatataagggtatcagc
tttgagattgttgaagaggtcatgccagattacgttgtagttccaacgagctctggtggt
ctgattagagggatcataaaaggcttccttgagctcaaaaagagtaagcttattgataag
ttgccaatgtttgtttgtgtccaagctgaaggttgctcaccgatttacaaagctttcatt
gaagggaaagaaaaaattgaaagatttgaaaatcagcacacgatagcgcatgcaattgaa
aatccatacccgccgagcggaaacgctgtattgaggcttttgagaaagctcaacggcatg
tgtgttgctgttagtgatgaggagatccttaaagctcagaggatgctggctcaagagggt
gtatttgtccagccagcttctgcaactggtatagcagctgtgaaaaagctcagagaagaa
ggcagaattaagggagatgaaagagttgtgagcatactaacaggagctgggcttaaaaca
ctgcatcagttggggagatttgaagttagagaatgtgaaatgaaaaggctgaaagattgt
ttggtagggcagatctaa

DBGET integrated database retrieval system