KEGG   Thermococcus barophilus: TERMP_01102Help
Entry
TERMP_01102       CDS       T01377                                 

Definition
acetyl-CoA synthetase subunit alpha
Orthology
K01905  
acetyl-CoA synthetase (ADP-forming) [EC:6.2.1.13]
Organism
tba  Thermococcus barophilus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tba00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tba00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:tba00640]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
959134..960522
Genome map
AA seq 462 aa AA seqDB search
MSIEALFKPKSVAVIGASGKPGKIGYAIMKNLIEYGYEGKIYAVNIKGGEIEISGRKFKV
YKSILDVPDEVDMAVIVVPAKFVPQVVEECGKKGVKVLPIISSGFGELGPEGKKVEEQLV
ETAHKYGMRILGPNIFGVVYTPAKLNATFGPTDVMPGSLALISQSGALGIALMGWTILEK
VGLSAVVSIGNKSDIDDADLLEYFKDDENTKAILIYMEGVKDGRKFMKAAKEVSMKKPII
VIKAGRSERGAKAAASHTGSLAGADSIYTAAFKQSGVLRALTIGEAFDWARTLSNLPEPP
GENVVIITNGGGIGVMATDAAEEEGLKLYDNLEELKVFANHMPPFGSYKNPVDLTGMADA
KAYEGAVRDALAHPEMHAIAVLYCQTAVLDPRDLARIVIDEYEKSGKKKPIVVAIVGGIE
AKEAIDILNENGIPAYPEPERAIKSLAALYRWSRWKASKRKE
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgagtattgaggcactattcaagccaaagagcgttgccgtcattggagcttctggaaag
ccaggaaagataggctatgcaatcatgaagaacctcatcgagtacggttacgaagggaaa
atctatgcagttaacatcaaagggggagaaattgagataagcgggagaaagttcaaggtc
tacaagagtattcttgatgttcccgatgaggttgatatggcagttatcgttgttcctgcc
aagtttgttccacaggttgtcgaggaatgtggaaagaaaggggttaaagtattaccaatc
ataagctcaggatttggtgaacttgggccagaaggcaagaaagtcgaagaacagcttgta
gagacagctcataagtatggaatgaggattctcggtccaaacatttttggtgtcgtttac
acaccagcaaagctcaacgcaaccttcggtccaacagatgtcatgccaggcagcttagcg
ttaatcagccagagcggtgctctcggtatagcccttatgggatggacaattcttgagaaa
gttggtctctcagcagttgtcagtattggaaacaagagcgatattgacgatgctgacctc
ttggagtactttaaggatgatgaaaacacaaaggcaatcctcatctacatggaaggcgtc
aaagacggtaggaagttcatgaaggctgcaaaagaggtcagcatgaaaaagccaattata
gtcatcaaggctggaagaagtgagagaggtgcaaaggcggcagcatcacacactggttca
ttggcaggtgctgatagcatttacaccgcagcattcaagcagagtggtgttctgagagca
ttaacaattggcgaagctttcgactgggcaagaacactcagcaacttaccagaaccacca
ggggagaatgtcgtcatcatcacgaacggcggtggaattggagtcatggcaacagatgca
gccgaagaggaaggattaaagctctacgacaaccttgaggagcttaaggtctttgcaaat
cacatgccaccattcggaagctacaagaacccggttgacttgaccggtatggcagatgca
aaggcttatgaaggtgctgttagagatgctttagctcatccagagatgcatgcaatagct
gttctctactgtcagaccgctgttttagatccaagagatttagcaagaatagtaattgat
gagtacgaaaagagcggaaagaagaagccaatagttgttgcaatcgtgggtggaattgag
gcaaaggaagcaattgacattctcaacgagaacggaatcccggcatatccagaaccggag
agggccatcaagtcattagccgctctgtacagatggagcagatggaaggcaagcaagagg
aaagagtga

DBGET integrated database retrieval system