KEGG   Thermococcus barophilus: TERMP_01216Help
Entry
TERMP_01216       CDS       T01377                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tba  Thermococcus barophilus
Brite
Enzymes [BR:tba01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     TERMP_01216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1072286..1073011
Genome map
AA seq 241 aa AA seqDB search
MKALRDKLKYFFSKFFFVRAMSEEELYERWVRLVRQLEREGIIKSKRIKTAFLKVPRYKF
VLDRYKHYAHVDEPLPIPAGQTISAPHMVAIMLEVADLKEGMNVLEIGTGSGWNAALIYE
LVKRDVYTIERIPELVEFAKRNLEEAGYKDKVHVILGDGTKGFPPKAPYDRIIVTAGAPK
IPEPLIEQLKVGGKLIIPVGSYHLWQELYEVIKLDEKGRIKVINHGGVAFVPLIGEHGWR
E
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgttgagagataagctaaaatacttcttctccaaattcttttttgtgagagca
atgagtgaggaagagctatatgagagatgggtaaggcttgttaggcagcttgaaagggag
ggaataattaagagtaagcggattaagacagctttcctgaaagtccccaggtataagttt
gttcttgacagatacaagcactatgctcatgttgatgaacccctgcctattcctgcggga
cagacaattagcgctccccatatggtggctataatgttggaagttgccgatctaaaggag
ggcatgaatgttctcgaaattggaactggaagtggatggaatgccgccttaatatatgag
cttgtcaagagagatgtttacacaattgagcgaatccccgagctggtagagtttgcaaag
agaaacttggaagaagctggctacaaagataaagttcatgtgattttgggagacggaaca
aaaggattcccccctaaagctccatatgacagaatcatagtcacagcaggtgccccaaaa
attccagaaccccttatagaacagctcaaagttggtggaaagttgataatacccgttgga
agttatcatttatggcaagagttatatgaggtaataaagcttgatgaaaaagggagaata
aaagtgataaaccacggaggagttgcgtttgttccgctaattggagagcatggatggagg
gaataa

DBGET integrated database retrieval system