KEGG   Thermococcus barophilus: TERMP_01272Help
Entry
TERMP_01272       CDS       T01377                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
tba  Thermococcus barophilus
Pathway
tba00010  Glycolysis / Gluconeogenesis
tba00260  Glycine, serine and threonine metabolism
tba00680  Methane metabolism
tba01100  Metabolic pathways
tba01110  Biosynthesis of secondary metabolites
tba01120  Microbial metabolism in diverse environments
tba01130  Biosynthesis of antibiotics
tba01200  Carbon metabolism
tba01230  Biosynthesis of amino acids
Module
tba_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tba_M00002  Glycolysis, core module involving three-carbon compounds
tba_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TERMP_01272
  Energy metabolism
   00680 Methane metabolism
    TERMP_01272
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TERMP_01272
Enzymes [BR:tba01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     TERMP_01272
Membrane trafficking [BR:tba04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    TERMP_01272
Exosome [BR:tba04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   TERMP_01272
  Exosomal proteins of melanoma cells
   TERMP_01272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Gemini_AC4_5
Motif
Other DBs
NCBI-ProteinID: ADT84248
UniProt: F0LH40
Position
complement(1108587..1109294)
Genome map
AA seq 235 aa AA seqDB search
MALLVLVRHGESLWNRLNIFTGWVDIPLSENGIREALKAGDLLKDYKFDVIFTSELVRAI
QTAMLIMSRNKHGVAKIEHENGKMKEWGTVYGEHGRNYIPVYKAWQLNERYYGKLQGWNK
DYARKVYGDEQVLLWRRSYDIAPPGGESLKDTAKRTIPYLKERIIPELEKGKNVLVSAHG
NSLRSVVMHIENLTKEEVLRLNIPTGIPLIYEYKNRKLIRKGYLTERGFINKLIE
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggcattattggttttagtcagacatggcgaaagcctgtggaacaggctgaacattttt
acaggctgggtggatattcctttaagcgaaaatggtattcgagaggcattaaaggctggc
gatcttctgaaggattacaagtttgacgtgatttttacttctgagcttgtgagagccatt
cagacggcaatgctgataatgagcagaaataagcacggagttgcaaagattgagcatgaa
aatggaaagatgaaagaatggggcactgtttacggagaacacggaagaaattacattcct
gtttataaggcttggcagcttaatgagcgctattatggaaagctccaaggctggaacaag
gattatgcaagaaaggtttatggtgatgaacaagttctgctttggagacgaagctatgac
atagcaccaccgggaggggagagtttaaaagatactgccaaaagaacgataccttatcta
aaagagagaataattccagagcttgagaaaggtaagaatgtcttggtttcagcccatgga
aacagtttaaggtcggtcgtaatgcatattgaaaatctcacaaaggaagaggtgcttaga
ctcaacatacctacgggaatacccctaatctatgagtataaaaatagaaagctcattagg
aaagggtatcttacagaaaggggatttataaataagctgattgagtaa

DBGET integrated database retrieval system