KEGG   Thermococcus barophilus: TERMP_01272Help
Entry
TERMP_01272       CDS       T01377                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
tba  Thermococcus barophilus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TERMP_01272
   01230 Biosynthesis of amino acids
    TERMP_01272
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TERMP_01272
  Energy metabolism
   00680 Methane metabolism
    TERMP_01272
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TERMP_01272
Enzymes [BR:tba01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     TERMP_01272
Exosome [BR:tba04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   TERMP_01272
  Exosomal proteins of melanoma cells
   TERMP_01272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1108587..1109294)
Genome map
AA seq 235 aa AA seqDB search
MALLVLVRHGESLWNRLNIFTGWVDIPLSENGIREALKAGDLLKDYKFDVIFTSELVRAI
QTAMLIMSRNKHGVAKIEHENGKMKEWGTVYGEHGRNYIPVYKAWQLNERYYGKLQGWNK
DYARKVYGDEQVLLWRRSYDIAPPGGESLKDTAKRTIPYLKERIIPELEKGKNVLVSAHG
NSLRSVVMHIENLTKEEVLRLNIPTGIPLIYEYKNRKLIRKGYLTERGFINKLIE
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggcattattggttttagtcagacatggcgaaagcctgtggaacaggctgaacattttt
acaggctgggtggatattcctttaagcgaaaatggtattcgagaggcattaaaggctggc
gatcttctgaaggattacaagtttgacgtgatttttacttctgagcttgtgagagccatt
cagacggcaatgctgataatgagcagaaataagcacggagttgcaaagattgagcatgaa
aatggaaagatgaaagaatggggcactgtttacggagaacacggaagaaattacattcct
gtttataaggcttggcagcttaatgagcgctattatggaaagctccaaggctggaacaag
gattatgcaagaaaggtttatggtgatgaacaagttctgctttggagacgaagctatgac
atagcaccaccgggaggggagagtttaaaagatactgccaaaagaacgataccttatcta
aaagagagaataattccagagcttgagaaaggtaagaatgtcttggtttcagcccatgga
aacagtttaaggtcggtcgtaatgcatattgaaaatctcacaaaggaagaggtgcttaga
ctcaacatacctacgggaatacccctaatctatgagtataaaaatagaaagctcattagg
aaagggtatcttacagaaaggggatttataaataagctgattgagtaa

DBGET integrated database retrieval system