KEGG   Thermococcus barophilus: TERMP_01323Help
Entry
TERMP_01323       CDS       T01377                                 

Definition
tungsten-containing aldehyde:ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tba  Thermococcus barophilus
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TERMP_01323
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TERMP_01323
Enzymes [BR:tba01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     TERMP_01323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1152250..1154067
Genome map
AA seq 605 aa AA seqDB search
MFGYQGKILRVNLTTGKISEEKIDENFAKKWLGTRGFGIYFLLKEMDPKAKPFSPENKLI
FATGPLTGTTAPTGGRYMVITKSPLTGYIAMANSGGFFGAELKFAGWDAIIFEGKADHPV
YLYINDDQVELRDASHIWGKVVSETEKILMEEVGDKRVQIASIGPAGENLVRFAAVMNNG
HRAAGRGGVGAVMGSKNLKAVVVRGHKRVEVADRQKFTSVVKEKIEKLKKDPVAGGGLPK
YGTAVLVNIINSNGLYPTRNFQDSQFEYAEEQSGEALAAKYLKRNKPCFACPIGCGRVTY
HPALGETEGPEYESIWALGANLGINDLASIVIANHLCDEYGLDTISTGGTLATAMELYEK
GLIKPEDLGDAPPLRFGNTEVLHYYIEKLTFRKGFGDKLAEGGYRLAEMYNGVEYFMGVK
KQELPAYDPRGAEGHGLAYATNNRGGCHIKNYMISPEILGYPYKMDPHDISDEKIKMVIL
FQDLTALIDAAGLCVFTTFGLGADDYRDMLNAALGWDFTTEEYLKIGERIWNAERLFNLK
AGLDPLKEDTLPKRLLEEPVKAGPNKGHVVRLKEMLPRYYALRGWTEEGKVPEEKIKELG
LEEVA
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgttcggataccaaggaaagattttgagggtaaacctgaccacaggaaagatcagcgaa
gagaagatcgatgaaaactttgcaaagaagtggctcggaacaagaggatttggtatctac
ttcctccttaaagagatggaccccaaggctaagccattcagcccggaaaacaaattgatc
tttgcgacgggcccattaacaggaactacagctccgacaggcggcagatacatggttatt
acgaagagcccgctaacaggatacattgcaatggcaaactctggtggattcttcggtgca
gagcttaaatttgctggatgggatgccataatattcgaaggaaaagcagaccaccctgtg
tatctctatataaacgacgaccaagttgagctcagagatgcttcacatatatggggtaaa
gtcgtcagtgagacagagaagatcctcatggaggaggttggtgacaagagggtgcagata
gcatcaatcggaccggctggtgaaaacttagttagattcgctgccgttatgaacaatgga
catagagcggcaggtaggggtggagtaggagctgtaatgggatcaaagaaccttaaggcg
gtggttgtgagaggccacaagagagttgaagttgctgacaggcagaagttcacaagtgtt
gtcaaggagaagattgagaagctcaagaaggatccagttgcaggtggaggactgccgaag
tacggaacagctgttctggtcaatataatcaactcaaatggattgtatccaacaagaaac
ttccaagacagccagttcgagtacgcagaagagcagagcggtgaggcattggctgccaag
tacctcaagaggaacaagccgtgctttgcatgtcccattggatgtggaagggtaacatac
catccagctcttggagaaaccgagggcccagagtacgagagcatctgggcacttggagcc
aaccttggaataaacgatcttgcaagcatagtaatagcgaaccatctctgtgacgagtac
ggtcttgacacaatctcaacaggcggtaccttggcgacggcaatggagctttacgaaaag
ggcctcataaagcctgaagacttaggcgatgctccaccactcaggtttggaaacacagaa
gttttgcactactacattgaaaaactgacattcagaaaaggattcggtgacaagcttgca
gaaggtggatacaggcttgctgagatgtacaacggcgttgagtacttcatgggcgttaaa
aagcaagaactgcctgcatatgatccaagaggtgccgaaggtcatggattggcatacgcc
acaaacaacagaggagggtgtcacattaagaactacatgatcagcccagaaatccttgga
tatccatacaagatggatccacacgacataagcgacgaaaagataaagatggtcattctc
ttccaagacctgacggcattaattgatgctgctgggctctgtgtattcacgacctttgga
cttggtgcagacgactacagagacatgctcaatgcagcccttggctgggacttcacaaca
gaagagtacctcaagatcggtgagagaatctggaatgcagagagactcttcaacctcaaa
gctggacttgatccactcaaagaggacacactgccaaagagacttcttgaagagcccgtc
aaagcaggaccaaacaagggacatgtcgtcaggctcaaggagatgcttccgagatactac
gcactcagaggatggacagaggaaggtaaggttccagaagagaagatcaaggagcttgga
cttgaggaagttgcttga

DBGET integrated database retrieval system