KEGG   Thermococcus barophilus: TERMP_01545Help
Entry
TERMP_01545       CDS       T01377                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tba  Thermococcus barophilus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tba00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TERMP_01545
Enzymes [BR:tba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     TERMP_01545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1334902..1335891
Genome map
AA seq 329 aa AA seqDB search
MHPVERLNCSLILTENGENLKAFQCATYEIKPTGGMAMFDVVAIGNLNYDIIMLVDRFPE
FHEKIPAKNAHFGLGGAAGNTATWLANMGLRVGFIGAVGKDEIGEAHINFFKKIGIDTKG
IKIVDVPSGVAVAIIKGEDKRIVKYLGANKYRELDYEYLSKTKHIHLSSNPEKLIIDTVN
FAYEHGITVSLDIGEAKIPEEIEEKITYLLMNEDEFKRKFGNLDKISEVKAKNVIVTLNG
GGALVRDEKGNIFEVKGLSAEVVDSTGAGDSFDAGLIYGVLKGWSLRDAAKLGMLLAYLT
VQKVGARSAVIPLEEIKKRAEELNLNLPF
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
ttgcacccagtagaaagactaaactgttctctgatattaacagaaaatggagaaaacctt
aaagcttttcagtgtgcaacatatgaaataaaacccaccggagggatggcaatgtttgac
gtggttgcaatagggaacctcaactacgacataataatgctcgttgaccgctttccggaa
ttccatgaaaagattccagcaaaaaatgcccactttggacttggaggagccgctggaaac
acagcaacatggttagccaatatgggccttagagtggggttcataggggctgtaggaaaa
gacgaaattggagaagcacacataaacttcttcaaaaagattggtattgacaccaaaggc
ataaaaattgttgatgttccttcaggtgttgccgtggcaataataaagggcgaagataag
agaattgtaaaatacttaggagccaacaaatacagagagcttgactatgaatatctatcc
aaaacaaaacacatccatctatcttccaatccagaaaagctcatcatcgacacagtaaac
tttgcttatgaacacggaattacagtctcacttgacattggggaggcaaaaatcccagaa
gaaatcgaggaaaaaataacatatcttctcatgaacgaggacgaatttaagaggaaattc
gggaacctggataaaatcagcgaggtcaaagccaaaaatgtgattgtaacactgaacgga
gggggagcattggtaagggacgaaaaaggaaacatatttgaggttaaaggactcagcgct
gaagtcgttgattccactggagcgggagactcctttgatgctgggctcatttatggggtt
ctcaaagggtggagtttaagagatgccgcaaagcttggaatgctcctggcttatctaact
gttcagaaagttggtgcaagaagtgcagtaattccccttgaagagataaaaaagagagcg
gaagagctgaatctcaacctgcctttctaa

DBGET integrated database retrieval system