KEGG   Thermococcus barophilus: TERMP_01554Help
Entry
TERMP_01554       CDS       T01377                                 

Definition
pyruvate:ferredoxin oxidoreductase subunit beta
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
tba  Thermococcus barophilus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TERMP_01554
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TERMP_01554
   00020 Citrate cycle (TCA cycle)
    TERMP_01554
   00620 Pyruvate metabolism
    TERMP_01554
   00640 Propanoate metabolism
    TERMP_01554
   00650 Butanoate metabolism
    TERMP_01554
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TERMP_01554
   00680 Methane metabolism
    TERMP_01554
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TERMP_01554
Enzymes [BR:tba01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TERMP_01554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1342433..1343380)
Genome map
AA seq 315 aa AA seqDB search
MAVRKPPITTREYWAPGHAACAGCGCAIIMRLATKAFSEAMEEKYGDPDAFAIAHATGCM
EVVSAVFPYTAWKAPWIHVAFENAAAVASGVEAAWKKLGYKGKILAFGGDGGTADIGLQA
LSGMLERRHNVVYIMYDNEAYMNTGIQRSSSTPYGAWTTTSPPGKYSIGEDKPKKWVALI
AAAHQIPYVATASIADPYDLYRKVKKAAKIDGPAFLQIHGPCVPGWRIPPEKTVEVAKLA
IETGVWPLFEIENGDIRNIKFQRFPKDGKFKKPIEEYLKLQGRFKHLFKRPEAIQELKEQ
IKAMWRVLGKEVELP
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggccgtaagaaagccccccatcacaactcgcgagtactgggcacctggtcacgctgca
tgtgctggatgtgggtgtgcaataattatgcgtttagccactaaagcatttagcgaagcc
atggaagagaaatacggcgatcctgatgcttttgcaatagcccatgcaactggatgtatg
gaggttgtttctgcagtatttccatacactgcttggaaggctccatggatccatgttgct
tttgaaaatgccgcagccgttgcaagcggtgttgaggcagcttggaagaagcttggctac
aaaggaaaaatccttgcattcggtggagatggtggtactgctgatattggtctgcaggca
ctctctggaatgctcgagagaaggcacaacgtcgtttacatcatgtatgataatgaggct
tatatgaatactggtattcagcgttcgagctcaacaccatacggagcatggacaacaaca
tcaccaccagggaagtactcgataggtgaggacaagccgaagaagtgggttgccttaata
gctgcagctcatcagatcccatacgttgcaacagcgagcattgcagacccatatgacctc
tatagaaaagtcaagaaggcggcaaagattgacggtccagccttcctgcagatacacggt
ccgtgtgtcccaggttggaggattccgccagagaagacagttgaagttgcaaaattagca
attgagactggcgtttggccactctttgaaattgaaaatggtgacataagaaacatcaag
ttccagagattccccaaggatggaaagttcaagaagccgattgaggaataccttaagctc
cagggaagattcaagcacctattcaagagacctgaggcaatacaagaactgaaagagcag
atcaaagcaatgtggagggttctcggaaaggaagttgagcttccatga

DBGET integrated database retrieval system