KEGG   Thermococcus barophilus: TERMP_01558Help
Entry
TERMP_01558       CDS       T01377                                 

Definition
2-oxoisovalerate:ferredoxin oxidoreductase subunit alpha
Orthology
K00186  
2-oxoisovalerate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.7]
Organism
tba  Thermococcus barophilus
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:tba00280]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1345921..1347099)
Genome map
AA seq 392 aa AA seqDB search
MPKKVVSGNYAAAYAAKHARVEVVAAYPITPQTSIIEKIAEFIANGEANIQYVPVESEHS
AMAACIGASAAGARAFTATSAQGLALMHEMLHWASGARLPIVMVDVNRAMAPPWSVWDDQ
TDSLAQRDTGWMQFYAENNQEVYDGVLMAFKVAEHKKVNLPVMIIESAFILSHTYDIVDM
PPQEEIDEFLPPREPLYTLTDFDNPIAVGALATPADYYEFRYKIEKAMEEARKVIKEVGK
EFGERFGRDYSQMIELYRTEDAEFVFMGMGSLMGTVKEAVDLLRKEGYKVGAAKVRWFRP
FPKEELYELAKNVDGIAVLDRNFSFGQEGILFNEAKGVLYNTDAHPIMKNYIVGLGGRDF
TVNDIRAIAKNMKEIIEKGRLDREIEWYHLKR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagaaagtcgtgagcggtaattatgcagctgcttatgctgcgaagcatgcaagg
gtcgaggttgttgctgcttatccaatcacaccgcaaacaagcataattgaaaagatagct
gagttcatagccaatggagaagcaaacatccagtatgtccctgttgagagcgaacattct
gccatggctgcctgtataggtgcttcagcagctggtgcgagagctttcactgccacatca
gcccaaggtttggctttaatgcacgaaatgctccactgggcaagcggtgcgagactgcca
atagtcatggttgatgtcaacagagcaatggctccaccctggagcgtttgggacgatcag
actgacagcttggctcaaagagatacaggctggatgcagttctacgccgaaaataaccag
gaggtgtatgacggcgttttgatggcatttaaagttgcagagcacaagaaggtaaatctt
cccgtcatgatcattgagagcgcattcatactgagccatacatacgatatagttgacatg
cccccacaggaggaaattgacgaatttttaccgccaagggaaccgttgtacacactgacg
gactttgacaatccgattgccgttggtgctctggcaactccagctgactactatgaattc
agatacaaaattgaaaaagcaatggaagaggcgagaaaggtcatcaaggaggtaggaaaa
gaatttggcgagagattcggaagggactactctcagatgattgagctttacaggacagaa
gatgcagaattcgtctttatgggaatgggttcattgatgggaacagttaaggaagccgtt
gatctgctcagaaaagagggatacaaagttggtgcagctaaagtcagatggttcagaccg
ttcccgaaggaggaactctatgaattagccaagaacgtggacggcatagcagtccttgac
agaaacttctcctttggacaggaagggatactcttcaacgaggcaaagggcgttctttac
aatacggatgcccatccaataatgaaaaactacatcgttggacttgggggaagggacttc
actgtcaatgacatcagggcaatagctaagaacatgaaggagatcatcgagaagggcagg
cttgatagggagatagagtggtaccacttgaagaggtga

DBGET integrated database retrieval system