KEGG   Thermococcus barophilus: TERMP_01560Help
Entry
TERMP_01560       CDS       T01377                                 

Definition
(GenBank) pyruvate:ferredoxin oxidoreductase gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
tba  Thermococcus barophilus
Pathway
tba00010  Glycolysis / Gluconeogenesis
tba00020  Citrate cycle (TCA cycle)
tba00620  Pyruvate metabolism
tba00633  Nitrotoluene degradation
tba00640  Propanoate metabolism
tba00650  Butanoate metabolism
tba00680  Methane metabolism
tba00720  Carbon fixation pathways in prokaryotes
tba01100  Metabolic pathways
tba01120  Microbial metabolism in diverse environments
tba01130  Biosynthesis of antibiotics
tba01200  Carbon metabolism
Module
tba_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TERMP_01560
   00020 Citrate cycle (TCA cycle)
    TERMP_01560
   00620 Pyruvate metabolism
    TERMP_01560
   00640 Propanoate metabolism
    TERMP_01560
   00650 Butanoate metabolism
    TERMP_01560
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TERMP_01560
   00680 Methane metabolism
    TERMP_01560
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TERMP_01560
Enzymes [BR:tba01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TERMP_01560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR MAF_flag10
Motif
Other DBs
NCBI-ProteinID: ADT84535
UniProt: F0LIT3
Position
complement(1347462..1348022)
Genome map
AA seq 186 aa AA seqDB search
MMIEVRFHGRGGQGAVTAANILAEAAFIEGKYVQAFPFFGVERRGAPVTAFTRIDEKPIR
IKTQIYEPDIVVVLDPSLLETVDVTAGLKDGGIVIVNTEKSKDEVLAKLKKKPAKLALVD
ATTIALEVLGLPITNTSILGAVAKATGIVKIESVETAIKETFSGELGEKNARAAREAFEK
TAVYEL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgatgatagaagttcgttttcatggtagaggtggacaaggtgcagttaccgctgcaaac
attttagctgaggcagcttttatagaaggcaaatatgtgcaggcatttccgttctttggt
gtcgagagaagaggagcaccagttacagcatttacaagaatcgatgagaagccaatcagg
ataaagacccagatatacgagccagacatcgtcgttgttttagacccatcacttctggag
accgttgatgttacagcgggtcttaaggatggaggaattgttattgtcaacacggaaaag
agcaaagacgaagttcttgcaaagctcaaaaagaagccagcaaagctggctttagttgat
gcaaccacaatagcccttgaggtgcttggattgccaattacgaacacctcaattctcggt
gcagttgcaaaggcaactgggatagttaaaatcgagagcgttgaaacggcaattaaggag
acattctccggggagctcggagagaagaacgcaagggccgcaagggaagcatttgaaaag
actgctgtttatgagctttaa

DBGET integrated database retrieval system