KEGG   Thermococcus barophilus: TERMP_01611Help
Entry
TERMP_01611       CDS       T01377                                 

Definition
ribulose-5-phosphate 4-epimeraselike protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
tba  Thermococcus barophilus
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tba00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    TERMP_01611
Enzymes [BR:tba01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     TERMP_01611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1403303..1403866
Genome map
AA seq 187 aa AA seqDB search
MSQLIKSILVKYSRLAHERGLTAAFGGNLSILFNGKIFIKATGAVMDTMTEQQVAVIDLN
GKQISAVKPSSEWRLHLFIYREREDIRAIAHLHPPYSIVASIILKGELPIITPEAEIYLK
KIPIAEFKPAGSEELAKEVTKYIKNHDAVLMERHGIVTVGKSLREAFYKAELVEESAKLW
YLIEGKR
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagctcataaagtctattcttgtcaagtattcgcgcttagctcatgagagagga
ttaactgctgcatttggcggaaatctgagcattctttttaacggaaagatattcataaaa
gccacaggagctgttatggataccatgacggagcagcaagtggcagtcattgacctgaat
gggaagcaaatctcagctgttaagccttcatcagaatggaggctccatttgttcatttac
cgcgaaagagaagacataagggcaatagctcatcttcatcctccatactccattgttgcc
tcaatcattttgaagggagaacttccaataataaccccagaagcagaaatctatctcaag
aaaattccaattgcagagtttaagccagcgggaagcgaagaacttgcaaaagaagtcaca
aaatacattaaaaatcatgatgcagttttaatggagagacacggaattgtcacagtagga
aaaagcttgagagaagcgttctacaaagcggagcttgtcgaggaaagtgcaaagctttgg
tatttaatagagggcaaaaggtga

DBGET integrated database retrieval system