KEGG   Thermococcus barophilus: TERMP_01713Help
Entry
TERMP_01713       CDS       T01377                                 

Definition
histone acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
tba  Thermococcus barophilus
Brite
Enzymes [BR:tba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TERMP_01713
Transfer RNA biogenesis [BR:tba03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    TERMP_01713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1504723..1506492)
Genome map
AA seq 589 aa AA seqDB search
MDAYRKACEEIARMIISGEIKSREELNKVKVRVARKYHLSKLPGNADILRVMSKDDREKF
KDFLKKKPTRTISGVAVVAMMTKPFPCPHGRCIYCPGGPSEGSPQSYTGKEPSALRAIQS
AYHPYIIMLRRLKQLYDIGHDIDKVEVIVQGGTFPAMDLDYQEWFIKNAFKAMNDFPYFR
DVENLEEKLIRVLVKKDHSVFDEDPKFKAAWERTHKKKYYYLEDEQRKNEKAKVRMVGLT
IETRPDWSFERHIDRMLAFGTTRVELGVQTVFNFIYERVKRGHTVEDVVRATQLLKDAGL
KVNYHMMPGLPGSNFERDLKAFQIIFEDSRFKPDMLKIYPTLVTEDTILYKWYKEGKYRP
YTTEEAVRLLVEVYKIIPKWVRVMRIQRDIPVPLIAAGVKHSNLGQLVFNELIREGIRPR
EIRFREVGHVMQKFGIQPEVEHIKLLREDYEASEGREIFLSFEDVKNDILIGFLRLRIPS
EKAHRKEINCCPSAIVRELHVYGPLVPIGGRPKYEWQHRGYGRELLAEAEKIAREEFDVK
KMLVISGVGVREYYRKFGYRKDGPYVSKRLDKSYADFEKSREFDAHLNT
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atggatgcttatagaaaagcctgcgaggaaatcgctcggatgataatttcgggtgagatt
aaaagcagagaggaattgaacaaggttaaggttagagttgcgagaaaatatcatttgagc
aagcttcccggtaacgctgacatcttgagggttatgagcaaagatgatagggagaagttc
aaagacttccttaagaagaagcccacgaggacaataagcggtgttgcagttgttgcaatg
atgacaaagccttttccatgtcctcatggcagatgcatttactgtcctggtggaccgagt
gaaggttcgccgcagagctataccggaaaagagccgtcagctttgagagcaattcaaagt
gcttatcacccttacataatcatgctccgccgtttaaagcagctctatgacataggacac
gacattgataaagttgaagtgattgttcaaggcggaacatttcccgcaatggacttggat
tatcaagaatggttcataaaaaatgcatttaaagctatgaacgactttccttactttagg
gacgtagagaaccttgaggagaagctgattagggttttagttaaaaaagaccactcggta
tttgacgaagacccgaagtttaaagccgcatgggagagaacccataagaaaaaatactac
tacctcgaagacgagcagagaaagaatgagaaggcaaaggtcagaatggtcggcttgact
attgaaactcgtccagattggtcttttgaaaggcatattgatagaatgcttgcctttggt
actacaagagtggagcttggtgtccaaactgttttcaacttcatatatgaaagggttaag
aggggacataccgttgaagacgttgttagagcgactcagcttttgaaggatgctgggctt
aaagtaaactatcacatgatgcctggtttgccgggaagcaactttgagagggatttaaag
gcatttcagataattttcgaagattcccgctttaaaccagatatgctgaagatttatccg
acgcttgtaactgaggacacaatcctgtacaagtggtacaaagaaggcaaatacagacca
tacaccactgaagaagcagttaggcttttggttgaagtttacaagataattccaaagtgg
gttcgcgttatgaggatccagagagatattcccgttcctttaatcgctgctggagttaag
cactccaacctgggacagcttgtcttcaacgagctcatcagggagggcataaggccaaga
gagatcagattcagagaagttggtcatgtaatgcagaagtttggaattcagcccgaggtg
gagcatataaagcttttgagagaggactatgaggcaagcgagggcagagaaatttttctc
agctttgaggatgttaagaacgacattctaattggattccttaggttgaggattccgagc
gaaaaagctcaccgcaaagagattaactgctgtccctctgcaattgttagggaacttcac
gtttatggtccattggtgccaattggaggcagacctaaatatgagtggcagcaccgtggc
tacggcagggagctgcttgcggaggcggagaaaatagcgagagaggagtttgacgtcaag
aagatgcttgtcatcagcggcgttggagttagggaatattacagaaagttcggttataga
aaagacggtccttatgtgagcaaacgcttagataaaagctatgcagactttgaaaagagc
agagagtttgatgcacatttgaacacttga

DBGET integrated database retrieval system