KEGG   Thermococcus barophilus: TERMP_01833Help
Entry
TERMP_01833       CDS       T01377                                 

Definition
(RefSeq) glyceraldehyde-3-phosphate: ferredoxin oxidoreductase
  KO
K11389  
glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
tba  Thermococcus barophilus
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TERMP_01833
   01230 Biosynthesis of amino acids
    TERMP_01833
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TERMP_01833
Enzymes [BR:tba01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.6  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin)
     TERMP_01833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1616896..1618854
Genome map
AA seq 652 aa AA seqDB search
MKFTTLKINLKTKEISMNEIQQEGIYGIIDYALYLHDEVYKTYELDPYDPKNITVFGKGP
FAGSVLPGAHRLVFIFRSPLYGTLFPSTMGGAAYIFQRVGVDFVVLEGKRDKPTIILLQG
DGENVSVELHEMELEKLLQIWRSYKGEEGVYALTEYLIENFKDKFDEEFRIACVGPASLN
TNFGAIFSQTLKNGKRVEGSEDWAARGGPGSVLLRAHNVVAIIFGGKAKKEFPGENIGDI
KVARPIVEGVHKKPMFQVIGEKTTKYRYNPKLKTGGTFGGNYPAEGDFVPILNWQMPYIN
KEERIKIHENIMKHYWEPFNKEAIETKNWTTCGEPCPVVCKKFRRGHHVEYEPYEANGPL
SGSIYIYASDISVHAVDAMGFDAIEFGGLASWVLELVYRGLLKPEEVGLSGKPDFTKDDL
ILKPVEASEKNARLVAELAHKVAFAETEIAKILGLGKRKASAILDEKFKDRLKYGESFKD
YAVFTPLGEDGEICPTMYWAIGNYIPLPIQGRYWTFYQFGVFLEPEELASKIVASALYEF
WYDNVGWCRFHRGWMKPVLKALFLEAYGENVDMEEHAKKVIRKLINYAKKAGYEPVFWDS
MRVVDLVAAGAEEFGNEKWAEKFKEDKVGTAKEYLKRVLDTYSEILGVDWTI
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcacaaccctcaaaattaacctgaaaaccaaagaaatcagcatgaatgaaata
cagcaggaaggaatctacggaataattgactatgccctctatcttcatgatgaagtctat
aaaacatatgaactcgatccctacgacccaaaaaatattaccgtctttgggaaaggacca
ttcgcaggatcggttttgcctggagcccacagacttgtattcatcttcagatcaccactc
tatggaaccctcttcccatcaacaatgggcggggcagcatacatttttcagagagttggt
gtggacttcgtagttcttgaaggaaaaagggataaaccaaccattatcctgttgcaggga
gacggagaaaacgttagtgttgagcttcatgagatggagcttgaaaagctcttacaaatc
tggcgtagctataaaggggaagagggagtctatgcactaactgaatatcttattgaaaac
ttcaaagacaaatttgacgaagaatttagaatcgcctgcgtaggaccagcctcacttaac
accaactttggagcaatattctcacagactttaaaaaatggaaagcgtgtagagggaagc
gaagactgggcagctcgcggcggtcctggaagtgttctgctcagggcacataatgttgtg
gcaataatctttggaggaaaagccaaaaaagagttcccaggtgagaacataggggatata
aaagtcgcaagacccatagtcgaaggagttcataaaaagcccatgtttcaagttattgga
gaaaaaacaaccaagtatcgctataatccaaagctgaaaaccggcggaacattcggagga
aactatccagctgaaggtgactttgtcccaattttaaactggcagatgccctacattaac
aaagaagagaggattaaaatccacgagaacataatgaagcactactgggagcctttcaac
aaggaagcaatagaaaccaaaaactggacaacctgtggagaaccgtgtcccgttgtttgc
aaaaagttccgcagaggccaccacgttgaatatgagccatatgaagccaatggaccatta
agcgggagcatttacatctatgcaagcgatataagtgtccatgcagtcgatgctatgggt
tttgatgccatcgagtttggtggcttagcctcatgggttcttgagcttgtctataggggg
ttactcaagccagaggaagtgggattaagtggcaaaccagactttacaaaagatgatctg
attctaaagcccgttgaagcgagtgaaaagaacgcaagacttgttgcagaattggctcat
aaggtagcttttgcagaaacagaaattgccaaaatccttggcttaggaaagaggaaagca
agtgcaatacttgatgagaagttcaaagataggctgaaatatggggaaagcttcaaggac
tatgcagtctttacacctcttggcgaagatggagaaatctgcccgacaatgtattgggct
ataggaaattacattccactaccaatccaagggaggtactggacattttatcagtttggc
gttttccttgagccagaagagttagcaagcaaaatagtggcaagtgccttgtatgagttc
tggtatgacaatgttggatggtgcagattccacaggggatggatgaagccagttcttaaa
gctctcttcctcgaagcctatggcgagaatgttgacatggaggaacacgcaaagaaagtc
ataagaaagctcataaactatgcaaagaaagctggttacgagcctgtattctgggacagc
atgagggtcgttgatttggttgccgctggtgctgaagagtttggaaacgaaaagtgggca
gaaaagttcaaggaagacaaagttggcactgcaaaagaatacctcaagagagtacttgat
acttacagcgaaattttgggagttgattggacgatctaa

DBGET integrated database retrieval system