KEGG   Thermococcus barophilus: TERMP_01834Help
Entry
TERMP_01834       CDS       T01377                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tba  Thermococcus barophilus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TERMP_01834
   01230 Biosynthesis of amino acids
    TERMP_01834
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TERMP_01834
   00051 Fructose and mannose metabolism
    TERMP_01834
   00562 Inositol phosphate metabolism
    TERMP_01834
Enzymes [BR:tba01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TERMP_01834
Exosome [BR:tba04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TERMP_01834
  Exosomal proteins of bladder cancer cells
   TERMP_01834
  Exosomal proteins of melanoma cells
   TERMP_01834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1618898..1619575
Genome map
AA seq 225 aa AA seqDB search
MKLKEPIIAINFKTYAQATGEGALRIAKAAEKVYKETGITIVVAPQLADLYRIAQEVEIP
VFAQHIDPIKPGSHTGHVLPEAVKEAGAVGTLLNHSENRMILADLEAAIRRSEEVGLMTM
VCSNNPKVSAAVAALDPDYVAVEPPELIGTGIPVSKAKPEVITDTVELVKKVNPNVKVLC
GAGISTGEDVKKALELGTVGVLLASGVTKAKDPEKAIWDLVSLIV
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgaaagaaccaattattgcaatcaattttaagacgtatgcccaggccactgga
gaaggagccttgagaattgcaaaagctgccgaaaaagtttacaaggagacaggaataaca
attgtagttgctccacagcttgcagatctttatagaatagctcaagaggttgagattcca
gtctttgcccagcatattgacccaataaagcctggcagtcatacgggtcacgttctacca
gaggctgtcaaagaagcgggagccgttggaactctgttaaaccattcagaaaacagaatg
attttggctgatttggaggctgcaatcaggagatctgaagaagttggcttgatgacaatg
gtctgttcaaacaaccccaaggtttcagcagctgttgctgcattagaccctgattatgtt
gctgttgagcctccagagctcataggaaccggcataccggtgagcaaagcaaaacctgaa
gtcattacggacacagttgagcttgttaaaaaggtcaacccgaatgtaaaggttctctgc
ggtgcgggaatttcaacaggtgaagatgtaaagaaggcgttagagctcggaacagttggg
gtcctcttagcaagcggagttacaaaagcaaaagatccagaaaaagcaatttgggattta
gtttccctgattgtttga

DBGET integrated database retrieval system