KEGG   Thermococcus barophilus: TERMP_01834Help
Entry
TERMP_01834       CDS       T01377                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tba  Thermococcus barophilus
Pathway
tba00010  Glycolysis / Gluconeogenesis
tba00051  Fructose and mannose metabolism
tba00562  Inositol phosphate metabolism
tba01100  Metabolic pathways
tba01110  Biosynthesis of secondary metabolites
tba01120  Microbial metabolism in diverse environments
tba01130  Biosynthesis of antibiotics
tba01200  Carbon metabolism
tba01230  Biosynthesis of amino acids
Module
tba_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tba_M00002  Glycolysis, core module involving three-carbon compounds
tba_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TERMP_01834
   00051 Fructose and mannose metabolism
    TERMP_01834
   00562 Inositol phosphate metabolism
    TERMP_01834
Enzymes [BR:tba01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TERMP_01834
Exosome [BR:tba04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TERMP_01834
  Exosomal proteins of bladder cancer cells
   TERMP_01834
  Exosomal proteins of melanoma cells
   TERMP_01834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG FMN_dh IGPS His_biosynth B12-binding NMO DHO_dh NanE
Motif
Other DBs
NCBI-ProteinID: ADT84809
UniProt: F0LKH5
Position
1618898..1619575
Genome map
AA seq 225 aa AA seqDB search
MKLKEPIIAINFKTYAQATGEGALRIAKAAEKVYKETGITIVVAPQLADLYRIAQEVEIP
VFAQHIDPIKPGSHTGHVLPEAVKEAGAVGTLLNHSENRMILADLEAAIRRSEEVGLMTM
VCSNNPKVSAAVAALDPDYVAVEPPELIGTGIPVSKAKPEVITDTVELVKKVNPNVKVLC
GAGISTGEDVKKALELGTVGVLLASGVTKAKDPEKAIWDLVSLIV
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgaaagaaccaattattgcaatcaattttaagacgtatgcccaggccactgga
gaaggagccttgagaattgcaaaagctgccgaaaaagtttacaaggagacaggaataaca
attgtagttgctccacagcttgcagatctttatagaatagctcaagaggttgagattcca
gtctttgcccagcatattgacccaataaagcctggcagtcatacgggtcacgttctacca
gaggctgtcaaagaagcgggagccgttggaactctgttaaaccattcagaaaacagaatg
attttggctgatttggaggctgcaatcaggagatctgaagaagttggcttgatgacaatg
gtctgttcaaacaaccccaaggtttcagcagctgttgctgcattagaccctgattatgtt
gctgttgagcctccagagctcataggaaccggcataccggtgagcaaagcaaaacctgaa
gtcattacggacacagttgagcttgttaaaaaggtcaacccgaatgtaaaggttctctgc
ggtgcgggaatttcaacaggtgaagatgtaaagaaggcgttagagctcggaacagttggg
gtcctcttagcaagcggagttacaaaagcaaaagatccagaaaaagcaatttgggattta
gtttccctgattgtttga

DBGET integrated database retrieval system