KEGG   Thermococcus barophilus: TERMP_02170Help
Entry
TERMP_02170       CDS       T01377                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tba  Thermococcus barophilus
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tba01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:tba00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1956947..1958275
Genome map
AA seq 442 aa AA seqDB search
MRCPRCGREYSSFIPPRCLCGELLEITYDYSNVDPGKWKSREKGVWRYKELLPEVDEIVT
LKEGGTPLVKAKIGEELNLNVYIKDETRNPTGSFRDRLVTVGVSYGLPYSDNGFIVASDG
NAAASLAAYAARANREAFVVVPRRVDKGKLIQMIAFGAKIIRYGDSVDECVDYAKELAKL
NGLYDITPENNIIGLEGQKTVAFELWEEINPTHVVIPTGSGSNLYSIYKGFKELLEIGAI
EELPKLIAVQTDKCNPIASEILGIKQKREFTKALGLYVKDPVNRERAVKAVKESGGTAVV
VREDELDLGEKLLAKEGVFVEYASAVVVPALIKLSNEGYFEKDDRIVLIVTGSGLKSYYI
DEREKFSIGGTKLKILKLLKEKPMYGYEIWENLEKPMKYQAVYQHIKELESLGLIEEACK
KGRKIYYKLTEKGQRLLENFEE
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgagatgtccaagatgtgggagagagtattcctcttttattcctccgcggtgcttatgt
ggtgaactgcttgagataacatatgactactccaatgttgatcctggaaaatggaaaagc
cgtgagaaaggagtttggcgctataaagaacttttacctgaagttgacgaaatcgtgact
ctcaaggaagggggaactcccttagtgaaagctaaaattggtgaagagctaaatcttaat
gtctacataaaagatgagactcgaaatcctacaggctcctttagagacagacttgtaact
gttggcgtctcttacggtcttccctattctgataatggttttatagttgcaagcgatgga
aatgctgctgcttctttagctgcttatgctgcgagagctaacagagaggcttttgttgta
gtgccgagaagggttgataagggaaagctcatccagatgatagcttttggtgcaaagata
atccgctatggggacagtgttgatgagtgtgtagattacgctaaagagcttgcaaagctc
aatggcttatacgatataaccccagagaacaacataattggattagagggacagaaaact
gtagcttttgagctttgggaagagataaatccaacacatgttgttattccaacgggaagc
gggagcaacctctacagcatttataagggctttaaggagcttttggagattggggcaatt
gaggaattgccaaagctaatagctgttcaaacagataagtgcaacccaatagcgagtgaa
attttggggataaaacaaaagagagaattcacaaaagctttggggctttatgttaaagac
ccagtaaatcgagaaagagcagttaaagctgtaaaagaaagtggtggaacagctgttgta
gttagggaagatgaacttgacttgggagaaaagctattggctaaagagggtgtttttgtt
gaatatgcatcagctgttgtagttccggctctcatcaagcttagcaatgagggatatttt
gaaaaagacgataggattgttctcattgtcaccggttccgggctcaagagctattatata
gatgagcgggagaaattctccattggtggaactaagctcaaaattctcaaactgctgaaa
gaaaagcctatgtacggctatgaaatatgggagaacttagaaaagccaatgaaatatcag
gctgtttaccagcacattaaagagcttgagagcttagggctcatagaggaagcatgcaag
aaagggagaaagatttactacaaattgactgaaaagggacagcgtttgttggagaacttt
gaagaatag

DBGET integrated database retrieval system